KEGG   Edwardsiella piscicida C07-087: ETAC_15735Help
Entry
ETAC_15735        CDS       T02509                                 

Definition
(GenBank) DNA-binding transcriptional dual regulator Crp
  KO
K10914  CRP/FNR family transcriptional regulator, cyclic AMP receptor protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
etc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_15735
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ETAC_15735
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:etc03000]
    ETAC_15735
Transcription factors [BR:etc03000]
 Prokaryotic Type
  Helix-turn-helix
   CRP/FNR family
    ETAC_15735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: cNMP_binding HTH_Crp_2 Crp MarR_2 HTH_23 RepL HTH_36 MarR HTH_24 Sigma70_r4 HTH_7 Rrf2 HTH_11 HTH_38 DUF4868 HhH-GPD RPA_C
Motif
Other DBs
NCBI-ProteinID: AGH75268
Position
complement(3549709..3550341)
Genome map
AA seq 210 aa AA seqDB search
MVLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEM
ILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQ
MARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCS
RETVGRILKMLEDQNLISAHGKTIVVYGTR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggttctcggcaaaccgcaaacagatccaactctcgaatggttcctgtcccattgccat
attcacaaatatccgtccaaaagtaccttgattcaccagggtgaaaaagcggagacgctt
tattacatcgtaaagggatctgtagcggtactgattaaggatgaagagggtaaggagatg
atcctctcctacctgaaccagggcgacttcattggcgagctggggctgtttgaggaaggg
caggagcgcagcgcctgggtgcgggcgaagaccgcctgtgaggtggctgaaatttcctac
aagaaattccgccagctgatccaggttaacccggatattctgatgcgtctgtctgcccag
atggcgcgtcgtctgcaggtcacgtcagagaaagtcggtaacctggccttcctggatgtg
acgggccgtattgctcagacgctgttgaatctggccaagcagccggatgcgatgacgcac
ccggacggcatgcagattaagatcacccgtcaggagatcggccagatcgtgggctgctct
cgtgaaacggtaggacgtattctgaagatgctggaggatcagaacctgatctcggcacac
ggtaaaaccatcgtcgtctacgggacgcgttga

DBGET integrated database retrieval system