KEGG   Edwardsiella piscicida C07-087: ETAC_15875Help
Entry
ETAC_15875        CDS       T02509                                 

Gene name
ftsX
Definition
(GenBank) cell division ABC transporter subunit FtsX
  KO
K09811  cell division transport system permease protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00256  Cell division transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_15875 (ftsX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:etc03036]
    ETAC_15875 (ftsX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_15875 (ftsX)
Chromosome and associated proteins [BR:etc03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    ETAC_15875 (ftsX)
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Cell division transporter [MD:M00256]
    ETAC_15875 (ftsX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsX_ECD FtsX
Motif
Other DBs
NCBI-ProteinID: AGH75296
Position
complement(3586999..3587967)
Genome map
AA seq 322 aa AA seqDB search
MSNKPNARTRRPDKSKALRGGWREQWRYAWVNTLADMLRQPLATLLTVMVIAISLTLPSV
CYLVYKNVSEAATQWYPTPQLTVYLDKALDDDAASQVIATLKQQDGVAKVNYLSREEALG
EFRNWSGFGGALDMLEENPLPAVAIITPKLSFESSATLNTLRDRVAAVKGVDEVRMDDSW
FARLAALTGLVGQVAGMIGVLMVVAVFLVIGNSVRLNIFSRRDTINVMKLIGATDGFILR
PFLNGGALLGFCGALLSLILSQTMVWQLDSAVARVASVFGTTFTLHGLSWDECLLLLLVA
TMIGWIAAWLATVQHLRRFTPQ
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagcaataaacccaatgcccggacgcgccgcccggacaagagcaaggccctgcgcggc
ggctggcgtgaacagtggcgctatgcctgggtcaataccctggcagatatgctgcgtcag
ccgctggcgacgctgctgacggtgatggtgatcgcgatctcgctgaccctgccgagcgtg
tgctacctggtctataagaacgtcagtgaggccgcgacccagtggtatcccacgccgcag
ctaacggtgtatctggacaaggcgctggatgacgacgccgccagtcaggtgatcgcgacc
ctcaaacagcaggacggcgtggccaaggtcaactacctgtcgcgtgaagaggcgctgggc
gagttccgcaattggtctggcttcggcggcgcgctggatatgctggaggagaaccctctg
ccggcggtggcgatcattacgccgaagctgagctttgagagcagcgcaaccctgaacacc
ctgcgcgatcgcgtagcggcggtgaaaggggtggatgaggtgcgcatggatgacagctgg
tttgcccgcctggcggcgctgactgggctggtcggccaggtggccggaatgatcggggtg
ctgatggtggtcgccgtattcctggtgatcggcaacagcgtccgtctgaatatttttagc
cgccgcgataccatcaatgtgatgaagcttatcggcgcgaccgatggctttattctgcgg
ccgtttctcaacggcggcgcgctgctggggttctgcggtgccctgctgtcgctgatcctg
tcccagaccatggtctggcagctggacagcgcggtcgcgcgggtggcctcggtatttggc
accacctttaccctgcacggtctcagctgggatgagtgtctgctgctgctgctggtcgcg
accatgatcggctggatcgctgcctggctggcgactgttcagcatttacgccgttttacg
ccgcagtaa

DBGET integrated database retrieval system