KEGG   Edwardsiella piscicida C07-087: ETAC_15880Help
Entry
ETAC_15880        CDS       T02509                                 

Definition
(GenBank) cell division transporter ATP-binding protein FtsE
  KO
K09812  cell division transport system ATP-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00256  Cell division transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_15880
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:etc03036]
    ETAC_15880
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_15880
Chromosome and associated proteins [BR:etc03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    ETAC_15880
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Cell division transporter [MD:M00256]
    ETAC_15880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 RsgA_GTPase AAA_16 AAA_25 AAA_23 AAA_22 AAA_33 AAA_30 MMR_HSR1 NTPase_1
Motif
Other DBs
NCBI-ProteinID: AGH75297
Position
complement(3587957..3588628)
Genome map
AA seq 223 aa AA seqDB search
MIRFEQVSKAYLGGRQALQGVDFHLRQGEMAFLTGHSGAGKSTLLKLICGIERPSAGHIW
FGGHDISRLKNREVPFLRRQIGMIFQDHHLLLDRTVYDNVAMPLIIAGASSEDIRRRVSA
ALDKVGLLDKAKNFPIQLSGGEQQRVGIARAVVNKPAVLLADEPTGNLDEALSEGILRLF
EEFNRVGVTVLMATHDMTLIARRRYRILTLSQGRMAGGVQHEQ
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcttcgaacaggtcagtaaagcgtatctgggcgggcgtcaggccctgcagggg
gtggattttcacctgcggcagggcgaaatggcgtttttgaccggccactccggggcgggg
aagagtaccctgctaaagctgatttgcggtattgagcgcccgagcgccgggcatatctgg
tttggcggtcacgatatcagtcggttgaagaaccgcgaagtgccgtttttacgccgccag
atcgggatgatcttccaggatcatcacctcctgctcgatcgcaccgtgtatgacaacgta
gcgatgccactgatcatcgccggcgccagcagcgaagacattcgtcgtcgggtgtcggcg
gcgctggacaaggtcggcctgctggataaagcgaagaacttccccatccagctgtccggc
ggtgagcagcagcgcgtcgggattgcccgcgcggtggtgaacaagccggcggtgctgctg
gctgacgagccgaccggtaacctggatgaggcgctgtccgaaggcattctgcgcctgttt
gaagagtttaaccgcgtcggggtcacggtgttgatggcgacccatgatatgacgctgatc
gctcggcgtcgctaccgtatcctgacgctcagtcaggggcgcatggctggaggggtgcag
catgagcaataa

DBGET integrated database retrieval system