KEGG   Edwardsiella piscicida C07-087: ETAC_15930Help
Entry
ETAC_15930        CDS       T02509                                 

Definition
(GenBank) formate dehydrogenase, alpha subunit, premature stop
  KO
K08348  formate dehydrogenase-N, alpha subunit [EC:1.17.5.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_15930
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.5  With a quinone or similar compound as acceptor
    1.17.5.3  formate dehydrogenase-N
     ETAC_15930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdop_Fe4S4 Molybdopterin DUF1358 Rieske_3 TAT_signal
Motif
Other DBs
NCBI-ProteinID: AGH75307
Position
3595244..3595831
Genome map
AA seq 195 aa AA seqDB search
MQVSRRQFFRICAGGMAGTTAAVLGFAPSLALAQTRQYKLLRAKETRNTCTYCSVGCGLL
MYSLGDGAKNAKESIFHIEGDPDHPVNRGALCPKGAGLIDFIHSESRLQYPEYRAPGSNV
WQRLSWDEAFTRIARLIKQDRDANFIATNAQGVTVNRWLSTGMLCASASSNETGYLTQKF
SRALGMLAVDNQARV
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtcagcagaagacaattcttcaggatctgcgctggcggtatggcaggaacaacg
gcagcggtgctgggcttcgccccgtcgctggctttggcgcaaacccggcagtacaagcta
ctgcgcgcgaaagaaacccgtaacacctgtacatactgttccgttggctgtgggctgttg
atgtacagcctgggggatggtgccaaaaacgcaaaggagagtatttttcatatcgaaggg
gacccggatcatccggtaaaccgcggcgcgctgtgtccgaagggcgccggtctcatcgat
tttatccacagcgaatcccgactgcagtacccagaataccgcgcgccgggctccaacgtc
tggcagcgcctcagctgggatgaggcctttacccgcatcgcccgcctgatcaagcaggac
cgcgatgccaacttcatcgccaccaacgcccagggcgtcaccgtcaaccgctggctgagc
accgggatgctatgcgcctcggcgtccagcaacgaaaccggctatctgacccaaaagttt
agccgggcgctggggatgctggcagtcgataaccaagcacgtgtctga

KEGG   Edwardsiella piscicida C07-087: ETAC_15935Help
Entry
ETAC_15935        CDS       T02509                                 

Definition
(GenBank) anaerobic dehydrogenase
  KO
K08348  formate dehydrogenase-N, alpha subunit [EC:1.17.5.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_15935
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.5  With a quinone or similar compound as acceptor
    1.17.5.3  formate dehydrogenase-N
     ETAC_15935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdopterin Molydop_binding
Motif
Other DBs
NCBI-ProteinID: AGH75308
Position
3595880..3598294
Genome map
AA seq 804 aa AA seqDB search
MTNHWVDIKNANLIVVMGGNAAEAHPVGFRWAMEAKIHNNAKLIVIDPRFTRTAAVADFY
TPIRSGTDIAFLSGVLLYLIDNNQINAEYVKNYTNASLLVREDFTFEDGLFSGYDADKRR
YDKRSWNYQLDDQGFAKRDDTLQDPRCVWNLLRTHVSRYTPEVVENLCGTPRADFLKVCE
YIAETSAPDKTTSFLYALGWTQHTVGAQNIRTMAMIQLLLGNMGMAGGGVNALRGHSNIQ
GLTDLGLLSTSLPGYMSLPSEQQTDLASYLAATTPKPTLPGQVNYWGNTPKFFVSLMKSF
YGDKAQAQNSWGFDWLPKWDKGYDVLQYFEMMSQGKVNGYICQGFNPVASFPNKNKVVDC
LSKLKFLVTIDPLNTETACFWQNHGELNAVDPTTIQTEVFRLPSTCFAEENGSIVNSGRW
LQWHWKGADAPGIARNDGEILSGIFLRLREMYAKEGGALPEAVLNMSWDYLTPENPHPEE
VARENNGRALADLTDPVSGAVIVKKGQQLSSFAQLRDDGSTASGCWIFAGSWTEEGNQMA
RRDNSDPSGLGNTLGWAWAWPLNRRILYNRASADPSGKPWDPKRELLHWDGAKWVGIDIP
DYSNAPPNSGVGPFIMQPEGMGRLFAIDKMAEGPFPEHYEPFETPLGTNPLHPNVVSNPA
ARVFKDDLAQMGKAEQFPYVGTTYRLTEHFHYWTKHALLNAIIQPEQFVEIGERLANSKG
IANGDTVKVSSNRGYIKAKAVVTKRIRTLQVNGKAVDTIGIPIHWGYLGVARPGFLANTL
TPFVGDANTQTPEFKAFLVNVEKV
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaccactgggtcgacatcaagaacgctaacctgatcgtggtgatgggcggtaac
gccgccgaggcccacccggtcggtttccgctgggcgatggaagccaaaatccataacaac
gccaagctgatcgtgatcgatccgcgctttacccgcaccgccgcggtggccgatttctat
accccgatccgctcgggcaccgatatcgccttcctctccggtgtgctgctgtacctgatc
gataacaaccagatcaacgccgaatatgtgaagaactacaccaacgccagcctgctggtg
cgggaggactttacctttgaagatggcctgttcagcggctacgacgcggacaaacgccgt
tacgataagcgcagttggaactaccagttggacgatcagggctttgccaaacgcgacgat
accctgcaggatccgcgctgcgtatggaatctgctgcgaacccacgtatcacgctatacc
ccagaggtggtcgaaaacctgtgcggcaccccgcgcgccgacttcctgaaggtctgtgaa
tacatcgcggagaccagcgcgccggataagaccacctctttcctgtacgccctgggctgg
acccagcatacggtcggcgcccagaacatccgcaccatggcgatgatccagctgctgctg
ggcaacatggggatggccggcggcggcgtcaacgcgctgcgcggccactctaacatccag
gggctgacggatctggggctgctgtcgaccagtctgccgggctatatgagcctgccgtca
gagcagcagaccgacctggccagctacctggccgccaccaccccgaaaccgaccctgccc
ggccaggtcaactattggggcaatacgcccaagttcttcgttagcctaatgaagtccttc
tatggcgataaggcgcaggcgcaaaacagctggggatttgactggctgcccaagtgggac
aaaggctacgacgtcctgcagtactttgagatgatgtcgcaggggaaggtcaacggctat
atctgtcagggctttaacccggtcgcctcgttcccgaacaagaacaaggtggtcgactgt
ctgtccaagctgaagttcctggtgaccatcgatccgctgaatacggaaaccgcctgcttc
tggcagaaccacggcgagctgaacgcggtcgatccgaccacgatccagaccgaggtcttc
cgcctgccctccacctgcttcgccgaagagaacggctccatcgtcaactccggacgctgg
ctgcagtggcactggaaaggcgccgatgcgccggggatcgcccgtaacgacggcgagatc
ctctccgggatcttcctgcgtctgcgcgagatgtacgccaaagagggcggcgcgctgccg
gaggcggtgctcaacatgtcctgggactacctgacgccggaaaacccgcatccggaagag
gtggcccgcgagaacaatggccgggcgttggccgatctgaccgatccggtcagcggcgcc
gtgatcgtcaagaagggacagcagctcagctccttcgctcagctgcgcgacgacggtagc
accgccagcggctgctggatcttcgccggtagctggaccgaagagggcaaccagatggcg
cgccgcgacaacagcgacccctccggcctgggcaataccctgggctgggcctgggcctgg
ccgctgaaccgccgcatcctgtataaccgcgcgtcggcggatccgtcagggaaaccctgg
gatcccaagcgcgaactgctgcactgggacggcgccaagtgggtcggcatcgatatcccg
gactacagcaatgccccgcccaacagcggcgtcgggccgttcatcatgcagccagaggga
atggggcgcctgttcgccatcgacaagatggccgaaggcccgttcccggagcactatgag
ccgttcgaaacgccgctgggcaccaacccgctgcaccccaacgtggtctccaacccggcg
gcgcgcgtctttaaagacgatctggcgcagatgggcaaggcggagcagttcccctacgtc
ggcaccacgtaccgtctgaccgaacacttccactactggaccaagcatgcgctgttgaat
gcgatcatccagccggagcagttcgtcgaaatcggtgagcggctggccaacagcaagggc
attgccaacggggatacggtgaaggtcagctccaaccgcggctatatcaaggccaaggcg
gtagtgaccaagcgcatccgcaccctgcaggtcaacggtaaggcggtcgataccatcggg
atcccgatccactggggttacctgggcgtggcgcgtcccggcttcttggccaacacgctg
acgccgtttgtcggcgatgccaatacgcagacgccggagttcaaggcgttcctggttaac
gtggaaaaggtgtaa

DBGET integrated database retrieval system