KEGG   Edwardsiella piscicida C07-087: ETAC_15945Help
Entry
ETAC_15945        CDS       T02509                                 

Definition
(GenBank) formate dehydrogenase-N subunit gamma
  KO
K08350  formate dehydrogenase-N, gamma subunit
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_15945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ni_hydr_CYTB DUF4405 PepSY_TM
Motif
Other DBs
NCBI-ProteinID: AGH75310
Position
3599247..3599903
Genome map
AA seq 218 aa AA seqDB search
MSKNNLILRTRFIDRACHWTVVICFFLVALSGIALFFPTLQWLTETFGTPQMGRILHPFF
GVLIFVTLLVMFFRFVRHNLFERQDIPWFKGIIEVLKGNEHLVARVGKYNPGQKAMFWSI
MSLILVLLITGIIIWRPYFADRFPIPLVRYSLLLHAVAAIVLIHAILIHIYMAFWVKGSI
KGMVEGKVSRRWARKHHPRWLEEVEEEEKEAQSGKKPS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaataatctgatcctgcgcacccggtttatcgaccgggcgtgtcactggacg
gtggtgatctgcttcttcctggtcgcgctatccgggatagcgctgttcttccccacgcta
cagtggctcaccgaaaccttcgggacaccgcagatggggcgtattctgcaccccttcttc
ggcgtgctgatctttgttaccctgctggttatgttctttcgcttcgtcaggcataacctg
ttcgaacgccaggatattccctggtttaaggggatcattgaggtgctgaagggcaacgag
cacctggtggcgcgcgtgggtaaatataacccggggcagaaagcgatgttctggagcatc
atgagcctgatcctggtgctgctgatcaccggcatcatcatctggcgcccctacttcgcc
gatcgctttccgatcccgctggtgcgctactcgctgctgctgcacgccgtcgccgccatc
gtactgatccatgccatcctgatccatatctacatggcgttttgggtcaaaggctcgatc
aaagggatggtggaaggcaaggtcagccgtcgctgggccagaaaacaccacccgcgctgg
ctagaggaagtggaagaagaagaaaaggaggcccagtccggtaagaagccgagctga

DBGET integrated database retrieval system