KEGG   Edwardsiella piscicida C07-087: ETAC_15965Help
Entry
ETAC_15965        CDS       T02509                                 

Definition
(GenBank) aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00260  Glycine, serine and threonine metabolism
etc00261  Monobactam biosynthesis
etc00270  Cysteine and methionine metabolism
etc00300  Lysine biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01210  2-Oxocarboxylic acid metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
etc_M00017  Methionine biosynthesis, apartate => homoserine => methionine
etc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAC_15965
   00270 Cysteine and methionine metabolism
    ETAC_15965
   00300 Lysine biosynthesis
    ETAC_15965
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    ETAC_15965
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     ETAC_15965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dhC Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AGH75314
Position
3603081..3604184
Genome map
AA seq 367 aa AA seqDB search
MKNVGFIGWRGMVGSVLMQRMSEERDFDAIRPVFFSTSQHGQPAPTFGGHRGTLQDASDI
DALKALDIIITCQGGDYTQAIYPRLRAAGWQGYWIDAASALRMQDDAIIILDPVNRAVID
RGLESGVKTFVGGNCTVSLMLMSLGGLFAADLVEWVSVATYQAASGGGARHMRELLTQMG
MLHGQVAPALENPASAILDIERRVTDLMRSGTLPTDNFGVPLAGSLIPWIDKALDNGQSR
EEWKGQAETNKILASAQAIPIDGLCVRVGALRCHSQAFTIKLKRDIAIPEVEQLLARHNE
WVRVIPNDRELSMRELTPAAVTGTLATPVGRLRKLNMGPQYLSAFTVGDQLLWGAAEPLR
RMLRLLL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgttggttttatcggctggcgcggcatggttggctcggtgcttatgcaacgc
atgagcgaagagcgcgacttcgacgctatccgcccggtctttttttcaacctcgcagcat
ggccagccggcgccgacgttcggcggccaccgcggcacgctgcaggatgcctccgatatc
gacgccctcaaggcgctggatattatcatcacctgtcagggcggcgattatacccaggcc
atctacccgcggctgcgggcggcgggctggcaggggtactggatcgatgccgcctcggcg
ctgcggatgcaggatgacgccatcattatccttgacccggtcaaccgcgcggtgatcgat
cgtggcctggagagcggagtgaaaacctttgtcggcggcaactgtaccgtcagcctgatg
ctgatgtccctgggcggactgttcgccgccgatctggtggaatgggtctccgtcgccacc
taccaggccgcctccggcggcggcgcgcgccatatgcgcgagctgctgacccagatgggg
atgctgcacggccaggtcgcgccggcgctggaaaacccggccagcgcgatcctggatatc
gagcgccgggtcaccgatctgatgcgcagcggcacgctgccgacggataactttggcgta
ccgctggccggcagcctgatcccgtggatcgataaggcgctggataacggtcagagccgc
gaggagtggaaggggcaggccgaaaccaacaagatcctggcgagcgctcaggcgattccg
atcgatggtctgtgcgtccgggtcggcgctctgcgctgccatagccaggcctttaccatc
aagctgaagcgcgatatcgccatcccagaggtggagcagctgctggcgcgccataacgaa
tgggtgcgggtgatccccaacgatcgcgagctgagcatgcgtgagctgacgccggccgcc
gtcaccggcacgctggccaccccggttggccgtctgcgcaagctgaacatgggaccgcag
tatctgtccgcctttaccgtgggcgaccagctgctgtggggcgccgccgagccgctgcgc
cgtatgctgaggctgctgctctag

DBGET integrated database retrieval system