KEGG   Edwardsiella piscicida C07-087: ETAC_16110Help
Entry
ETAC_16110        CDS       T02509                                 

Definition
(GenBank) 2-dehydro-3-deoxygluconokinase
  KO
K00874  2-dehydro-3-deoxygluconokinase [EC:2.7.1.45]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00030  Pentose phosphate pathway
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc01200  Carbon metabolism
Module
etc_M00061  D-Glucuronate degradation, D-glucuronate => pyruvate + D-glyceraldehyde 3P
etc_M00631  D-Galacturonate degradation (bacteria), D-galacturonate => pyruvate + D-glyceraldehyde 3P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ETAC_16110
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.45  2-dehydro-3-deoxygluconokinase
     ETAC_16110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: AGH75343
Position
3640810..3641739
Genome map
AA seq 309 aa AA seqDB search
MTSAKIAIIGECMIELSQKGADLTRGFGGDTLNTAVYLARQVPADRLSVHYVTALGCDTF
SGEMIDAWQQEGLQTGLVQRMSDKLPGLYVIETDAHGERTFYYWRNDAAARYWLQSVEAD
AICDRLAQFDYLYLSGISLAILDDASRARLMLLLQRCRDNGGKVIFDNNYRPRLWQGVEQ
ARGAYRAMLACTDIAFLTLDDEDLLWGQQPLDAVLERTHALGVSEVVIKRGADACLVSIG
AQRDEIPALRLAKEQVIDTTAAGDSFSAGYLSVRLLGGDVQTAAARGHLTASTVIQHRGA
IIPRDVMPA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcgcgaagattgccattattggcgaatgcatgattgaactgtcacagaaaggc
gcagatctgacgcgcggattcggcggcgataccctgaataccgccgtctatctggcccgt
caggtgccggccgatcgcctatcggtgcactatgtcaccgcgctgggctgcgacaccttc
agcggtgaaatgatcgatgcctggcagcaagaggggctacagacgggtctggttcagcgc
atgagcgataaactgccggggctgtatgtgatcgaaaccgacgcgcacggcgagaggacg
ttctactactggcgtaatgatgccgccgcccgctactggctgcagagcgtcgaagccgat
gctatctgcgatcgcctggcgcagtttgactatctgtatctcagcggcatcagcctggcc
attctggatgacgccagccgtgcgcgcctgatgctgctgctgcagcgctgtcgggacaac
ggcggcaaggttatctttgataataactaccgcccgcgcctgtggcagggggtcgagcag
gcccgcggtgcctatcgcgccatgctcgcctgcaccgacatcgcgtttctgacgctggac
gatgaagatttactctggggacagcagccgctggatgccgtgctggagcgtactcacgcc
cttggcgtcagcgaggtcgtcatcaagcgcggcgccgatgcctgcctggtctccatcggc
gcccagcgcgatgagatcccggcgctcagactggccaaagagcaggtcattgacaccacc
gcggccggagactccttcagcgcgggctatctgtctgtccgcctgctgggcggcgatgtg
cagacggcggcggcccggggacacctgacggccagcacggtgatccagcaccgcggtgcc
atcattccccgcgacgtcatgcccgcctaa

DBGET integrated database retrieval system