KEGG   Edwardsiella piscicida C07-087: ETAC_16120Help
Entry
ETAC_16120        CDS       T02509                                 

Definition
(GenBank) C4-dicarboxylate transporter DctA
  KO
K11103  aerobic C4-dicarboxylate transport protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_16120
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_16120
Transporters [BR:etc02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ETAC_16120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SDF
Motif
Other DBs
NCBI-ProteinID: AGH75345
Position
complement(3643617..3644897)
Genome map
AA seq 426 aa AA seqDB search
MKKSIFTSLYLQVLVAITIGILLGHFYPELGAQMKPLGDGFVKLIKMIIAPVIFCTVVTG
IAGMESMKAVGRTGAIALLYFEIVSTIALIIGLVVVNVLQPGAGMNVDPNALDAKAVAVY
ADQAAQQGIVAFLLDVIPSSVIGAFASGNILQVLLFAVMFGFALHHLGEKGQLIFNVIDS
FAKVIFGVINMIMKLAPIGAFGAMAFTIGKYGVGTLVQLGQLILCFYITCILFVVLVLGS
IAKATGFSIFRFIAYIKEELLIVLGTSSSESALPRMLDKMEKVGCQKSVVGLVIPTGYSF
NLDGTSIYLTMAAVFIAQATNAHMDIWHQVTLLVVLLLSSKGAAGVTGSGFIVLAATLSA
VGHLPVAGLALILGIDRFMSEARALTNLIGNGVATIVVAKRCRQLDEKQMRAVLGGRDSA
LRDPIA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagcatcttcacgagcctctatctacaggtgttggtggctatcactattggt
attttgctcggccatttctaccccgagctgggtgcccaaatgaagccgttgggcgatggc
tttgtcaaactgattaagatgatcatcgcgccggtgatcttttgtaccgtggtgaccggc
atcgccggtatggagagcatgaaagcggtggggcgcaccggcgccattgcgctgctctat
tttgagatcgtcagcaccattgcgctgatcatcggcctggtggtggtgaacgtgctgcag
ccgggcgcaggcatgaacgtcgacccgaacgcgctggacgccaaggcggtcgcggtctat
gccgatcaggcggcgcagcagggtattgtggctttcctgctcgacgtgatccccagcagc
gttatcggcgcctttgccagcggtaacatcctgcaggtgctgctgtttgcggtgatgttt
ggcttcgcgctgcaccatctgggtgaaaaggggcagctgatcttcaacgtgatcgacagc
tttgccaaagtgatttttggcgtgattaacatgattatgaagctggctcccatcggcgcc
ttcggtgccatggcgttcaccatcggtaagtatggggtggggacgctggtacagctggga
cagctgatcctgtgcttctatatcacctgcatcctgtttgtggtgctggtgctgggcagc
atcgctaaggcgacggggttcagcatattccgctttatcgcatacattaaggaagagctg
ctgatcgtactgggtacctcctcctcggagtcggcgctgccgcggatgctggataagatg
gagaaggtgggctgtcagaagtcggtggtggggctggtgatcccgaccggctactccttt
aacctggacggaacctctatctacctgactatggcggcggtatttatcgcccaggcgacc
aatgcccacatggatatctggcaccaggtgacgctgctggtggtgctgctgctctcctcg
aagggcgccgccggcgtgaccggcagcggcttcatcgtcttggctgcgactctgtcggcg
gtaggacatcttccggtggccgggctggcgctgatcctgggcatcgatcgcttcatgtcg
gaggcccgcgccctgaccaacctgatcggcaacggcgtcgcgacgatcgtggtcgccaag
cgctgccgtcagctggacgaaaaacagatgcgggccgtactcggcggtcgcgacagcgcg
ctgagggatcccatcgcgtag

DBGET integrated database retrieval system