KEGG   Edwardsiella piscicida C07-087: ETAC_16170Help
Entry
ETAC_16170        CDS       T02509                                 

Gene name
dppF
Definition
(GenBank) dipeptide transporter ATP-binding subunit
  KO
K12372  dipeptide transport system ATP-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00324  Dipeptide transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_16170 (dppF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_16170 (dppF)
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Dipeptide transporter [MD:M00324]
    ETAC_16170 (dppF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_16 SMC_N AAA_21 AAA_22 RsgA_GTPase AAA_29 IstB_IS21 AAA_33 Rad17 DUF2813 ATPase PRK
Motif
Other DBs
NCBI-ProteinID: AGH75355
Position
complement(3661470..3662462)
Genome map
AA seq 330 aa AA seqDB search
MSEAILQAPLLQAVDLKKHYPVKSGLFSPERLVKALDGVSFSLERGKTLAVVGESGCGKS
TLGRLLTMIETPSAGELYYQGQDLLQPDAQAQKLRRQKIQIVFQNPYASLNPRKKVGAIL
EEPLRINTSLSRDQRRERALAMMARVGLKTEHYDRYPHMFSGGQRQRIAIARGLMLNPDV
VIADEPVSALDVSVRAQVLNLMMDLQRELGLSYVFISHDLSVVEHIADEVMVMYLGRCVE
KGSKAAVFGNPRHPYTQALLSATPRLNPQMRRERIKLSGELPSPLNPPPGCAFNARCRCA
FDTCRQLQPPLRRYGDQMIACFAVEQEAGA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagccatattacaggcgccgttactgcaggcggtggacctgaaaaagcattat
ccggtcaagagcgggctgttttccccagaaaggctggtcaaggcgctggacggtgtctcg
ttcagcctggaacggggaaaaaccctggcggtagtcggggagtccggctgcggtaagtcg
acgctgggacgtctgctgacgatgatcgaaacgccgagcgccggcgagctctattatcag
ggccaggatctgctgcagcccgatgcgcaggcgcaaaagctgcgccgccagaagatccag
atcgtgttccagaacccctacgcctcgctgaacccgcgcaagaaggtcggcgcgatcctt
gaggagccgctgcggatcaatacgtcgctgtcgcgcgaccagcggcgcgaacgggcgctg
gcgatgatggcgcgggtcggtctaaagaccgagcactacgatcgctatccccatatgttt
tccggcggccagcgtcagcgtatcgccattgcccgcggcctgatgttaaatccggacgtg
gtgatcgccgatgagccggtgtcggcgctcgacgtgtcggtgcgagcgcaggtactcaat
ctgatgatggatctgcagcgggagctggggctctcctatgtctttatctcacacgatctg
tcggtggtggagcatatcgccgatgaggtgatggtgatgtacctgggacgctgcgttgag
aagggcagtaaggcggcggtgttcggcaatccgcgtcacccctatacccaggcgctgctg
tcggcgacgccgcggctgaatccgcagatgcgccgcgagcggatcaagctgagcggggag
ctgcccagtccgctcaatccaccgcccggctgcgcctttaacgcccgctgccgctgcgcc
tttgacacctgtcgccagctgcagccgccgctgcgtcgctatggcgatcagatgatcgcc
tgttttgccgtggaacaggaggcgggggcatag

DBGET integrated database retrieval system