KEGG   Edwardsiella piscicida C07-087: ETAC_16190Help
Entry
ETAC_16190        CDS       T02509                                 

Definition
(GenBank) dipeptide ABC transporter periplasmic substrate-binding protein DppA
  KO
K12368  dipeptide transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
etc02030  Bacterial chemotaxis
Module
etc_M00324  Dipeptide transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_16190
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    ETAC_16190
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_16190
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Dipeptide transporter [MD:M00324]
    ETAC_16190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: AGH75359
Position
complement(3665551..3667179)
Genome map
AA seq 542 aa AA seqDB search
MSSNHHVSTGRGAGAVALKWGVGLVALAIAGSLQAKTLVYCSEGSPEGFNPQLFTSGTTY
DASAVPIYNRLIEFKNGSTEIEPGLAESWEVSPDGKTYTFHLRKGVKWQGSKLFKPTRDF
NADDVVFSFERQRDPNHPYHKVSGGSYEYFQGMGLPELIAKVEKVNDSTVRIELNHPESP
FLADLAMDFASILSAEYADAMMKAGTPEKIDLEPLGTGPFQLVQYQKDSKILYKANKDYW
GPQPKIDRLVFSITPDASVRYAKLQKNECQVMPYPNPADLARMKQDKNITLLEQPGLNVG
YLSFNVDKKPLDNVKVRQALTMAVNKPAIIEAVYQKAGQPAKNLIPPTMWGYNDEIKDYP
YDPEKAKALLKEAGLAEGFSIDLWAMPVQRPYNPNARRMAEMIQADWDKIGVKAKIVTYE
WGEYLKRAKDGEHQTVMMGWTGDNGDPDNFFATLFSCDAAKQGSNYSRWCYQPFEAVIQP
ARAEADQAKRAELYRQAQVIMHDQAPALIIAHSTVYEPVRKEVKGYVVDPLGKHHFNQVS
LE
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccaatcatcacgtatctacggggcgtggcgcaggcgccgtcgcgctgaaatgg
ggcgtcggcctggtcgcgttggcgatcgccggcagtttgcaggcaaaaaccctggtgtac
tgttctgagggatcgcctgaggggtttaacccgcagctgtttacctccggtaccacctat
gacgccagcgcggtccccatctataaccgcctgattgagtttaagaacgggagcacggag
atcgagcccgggctggcggagagctgggaggtaagccccgatggcaagacctataccttt
catctgcgcaagggggtgaagtggcagggcagtaagctgtttaagccgacccgcgacttc
aacgccgatgacgtggtgttctccttcgaacgccagcgcgatccgaaccacccgtaccac
aaggtctccggcggcagctatgagtactttcaggggatggggctgccggagctgatcgcc
aaggtcgaaaaggtgaacgatagcacggtgcgcatcgaactgaatcacccggagtcgccg
ttcctggcagatctggcgatggatttcgcgtcgatcctgtctgctgaatatgccgatgcc
atgatgaaggcgggcaccccggagaagatcgatctggagccgctgggcaccggtcccttc
cagctggtgcagtaccagaaggattcgaagatcctctataaggccaacaaagactactgg
ggcccgcagccgaagattgaccgcctggtgttctccattacgccggatgcctcggtacgc
tacgctaagctgcagaagaatgagtgtcaggtgatgccgtacccgaacccggcggatctg
gcgcgcatgaagcaggataagaacattaccctgctggagcagccggggctcaacgtgggc
tacctgtcgtttaacgtcgataaaaagccgctggacaacgtcaaggtgcgtcaggcgctg
accatggcggtcaacaaaccggccatcattgaggccgtctatcagaaggccgggcagccg
gcgaaaaacctgataccgccgaccatgtggggctataacgacgagattaaggattacccg
tacgatccggagaaggccaaagcgctgctgaaagaggccggcttggcagagggattcagc
atcgacctgtgggcgatgccggtgcagcgtccctataaccccaacgcgcgccgcatggcc
gagatgatccaggcggactgggacaagatcggcgtaaaagccaagattgtgacctatgag
tggggggagtacctcaagcgcgcgaaagacggcgaacaccagacggtgatgatgggctgg
accggcgataacggcgatccggacaacttcttcgccacgctgttcagctgcgatgcggcc
aagcagggctccaactactctcgctggtgctatcagccgtttgaggcggtgattcagcca
gcgcgcgccgaggcggatcaggccaagcgcgccgagctgtatcgccaggcgcaggtgatt
atgcatgaccaggcaccggcgctgatcatcgcccactccaccgtctatgagccggtgcgt
aaagaggtgaagggctacgtcgtggatccgctgggcaagcatcacttcaatcaggtctcc
ctggagtaa

DBGET integrated database retrieval system