KEGG   Edwardsiella piscicida C07-087: ETAC_16205Help
Entry
ETAC_16205        CDS       T02509                                 

Definition
(GenBank) sensory histidine kinase UhpB
  KO
K07675  two-component system, NarL family, sensor histidine kinase UhpB [EC:2.7.13.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00473  UhpB-UhpA (hexose phosphates uptake) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_16205
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etc01001]
    ETAC_16205
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_16205
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ETAC_16205
Protein kinases [BR:etc01001]
 Histidine kinases
  NarL family
   ETAC_16205
Two-component system [BR:etc02022]
 NarL family
  UhpB-UhpA [MD:M00473]
   ETAC_16205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MASE1 HisKA_3 HATPase_c Thia_YuaJ DUF2232 HATPase_c_2 DUF4118 VHL_C
Motif
Other DBs
NCBI-ProteinID: AGH75362
Position
complement(3670261..3671793)
Genome map
AA seq 510 aa AA seqDB search
MQRLISSIAIFFCYTIAGFCLWAIGAALVTAPVDALLLFPFGLRMGILLQTPRRYWPGIL
AGDVAVQLFLSHQLGGGSWLWGTLGGLLLCMALAWASGDWLRRQQRQEVEWRWPLQQGAL
VALAALIQALSWSLATGAMPGPALLLGLCGGLTVAPTCLLIWHYLAQQIWLPLTPGILHR
PVNLRLRHIGGYLLLFALSLWLQHLAQHADLRRFVPFCLAIPIVFMSYRYGWQGALLATL
LNGVVLIATEPQGDAPHRDLLLSLLAQSLTGMLLGAGIERQRDLNRQLTQRLAENRSLAR
SLVMAQEMTRREIARELHDEVGQTITVIRTQAGIIRRLSDEPRLLASAEAIENHALRVYD
GVHDLLAQLWPASLSNLPLSAALSALLRDLAPPEQGTTAQLRWHIDDAALDDTLKITLYR
LCQEGVTNACRHARARHIEVEGWQDDGGLLHVNICDDGCGVDTLSLTPGYGLRGLRERIC
AMGGELRLESHQGTRLAVILPAVLSGEAEN
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtctgatctccagcatcgccatcttcttctgctataccatcgccggattttgc
ctgtgggctatcggcgcggcgctggtgacggcgcccgtcgacgcgctgctgctgtttccc
ttcggtctgcggatgggcattctgctgcagacgccgcgccgctactggcccggtatcctg
gccggcgacgtggccgtgcagctgtttttgagccatcagctgggcggcggcagctggctg
tggggaaccctggggggactgctgctgtgcatggccctcgcctgggcgtcgggagactgg
ctgcggcgccagcagcggcaagaggttgaatggcgctggccgctgcagcagggggcgctg
gtggcgctggcggcgctgatccaggcgctgtcctggtcgctggcgaccggcgccatgccg
gggccggcgctgctgctggggctgtgcggcgggttgacggtggcgccgacctgcctgctg
atttggcactatttggcgcagcagatttggctgccgctgacgccggggattctgcatcgc
ccggtcaacctgcgcctgcgccatatcggcggctatctgctgctgttcgcgctgagcctc
tggctacagcacctggcgcagcacgccgacctgcgccgctttgtccctttctgtctggcg
atccccatcgtcttcatgtcgtatcgctatggctggcagggggcgctgttggccacgctg
ctgaacggcgtggtgctgatcgcgacggagccgcagggcgatgccccgcaccgcgatctg
ctgctgtcgctgctggcgcagagtctgaccgggatgctgctgggcgccgggattgagcgg
cagcgcgatctgaaccgtcagctgacgcagcgtctggcggagaaccgttcattggcccgt
tcgctggtcatggcgcaggagatgacccggcgggagatcgcccgtgagctgcacgatgag
gtcggacagacgattacggtgatccgcacccaggcgggcatcattcgacggctgagcgat
gagccgcgtctgctggccagcgccgaggccatcgaaaaccacgccctgcgggtatatgac
ggcgtacacgatctgctggcgcagctgtggccggcatcgctgagcaatctgccgctgtcg
gcggcgctttcggcgctgctgcgcgatctggcgccgccggagcagggcaccacggcgcag
ctacgctggcatatcgacgacgccgcgttggacgacaccctgaaaattacgctgtaccgc
ctgtgtcaggagggggtgacgaacgcctgtcgccacgcgcgggcccgccatatcgaggta
gagggctggcaggacgacggtggcctgctgcacgtgaacatctgcgatgacggctgcggg
gtggatacgctcagcctgacgccggggtatggcctgcgcggcctgcgtgagcggatctgc
gccatgggcggggagctgcgcctggaaagccatcaggggacccgactggctgtgatcctg
cccgcagttttatccggcgaggcggaaaactag

DBGET integrated database retrieval system