KEGG   Edwardsiella piscicida C07-087: ETAC_16210Help
Entry
ETAC_16210        CDS       T02509                                 

Definition
(GenBank) two-component system response regulator
  KO
K07686  two-component system, NarL family, uhpT operon response regulator UhpA
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00473  UhpB-UhpA (hexose phosphates uptake) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_16210
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_16210
Two-component system [BR:etc02022]
 NarL family
  UhpB-UhpA [MD:M00473]
   ETAC_16210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE Sigma70_r4_2 HTH_23 Sigma70_ECF HTH_38 HTH_24 HTH_28 HTH_29 Sigma70_r4 HTH_40 DUF746 HTH_Tnp_ISL3 HTH_7 HTH_AsnC-type HTH_Tnp_1 Terminase_5 HTH_17 HTH_IclR
Motif
Other DBs
NCBI-ProteinID: AGH75363
Position
complement(3671793..3672383)
Genome map
AA seq 196 aa AA seqDB search
MTYRIAFIDDHYIVRSGFVQLLALEEDMAVVGEFSSAAEARAGLPGLDVQVCICDISMPD
ESGLDLLADLPSGLAVIMLSMHDSAALVELALDRGARGFLSKRCRPEDLVSAVRTVAQGG
VYLMPEIAQQLARTRIDPLTRREREVAMMLAQGLEVREVAERLGLSPKTVHVHRANLFVK
LGVNNNVELAHRLLGQ
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgacctaccgcattgcctttatcgatgaccactatatcgtgcggtccggcttcgtgcag
ctgctggcgctggaggaggatatggcggtcgtcggcgagttcagctcggcggcagaggcg
cgggccggcctgccggggctggatgtgcaggtctgtatctgtgatatctcgatgcctgat
gaaagtgggctggatctgctggccgatctgccctccgggctggcggtgatcatgctgtcg
atgcacgacagcgcggcgctggttgagctggcgctggatcgcggcgcgcgcggctttctg
tctaaacgctgccgtcccgaggatctggtcagcgcggtacgcaccgtcgcgcagggcggc
gtctatctgatgccggagattgcccagcagctggcgcgtacccgcatcgatcccctgact
cgccgcgagcgtgaggtggcgatgatgctggcccaggggctagaggtgcgagaggtggct
gaacgcctcggcctgtcgccgaaaaccgtacacgtccaccgcgccaacctgtttgttaag
ctaggggtaaacaacaacgttgagctggcgcaccgcctgttggggcagtga

DBGET integrated database retrieval system