KEGG   Edwardsiella piscicida C07-087: ETAC_16270Help
Entry
ETAC_16270        CDS       T02509                                 

Definition
(GenBank) cystathionine beta-lyase/cystathionine gamma-synthase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00270  Cysteine and methionine metabolism
etc00450  Selenocompound metabolism
etc00920  Sulfur metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Module
etc_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    ETAC_16270
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ETAC_16270
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ETAC_16270
Enzymes [BR:etc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     ETAC_16270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AGH75375
Position
complement(3685467..3686627)
Genome map
AA seq 386 aa AA seqDB search
MRYQPATQAVRCGLNDDEQYGSVVPPIHLSTTYNFTDFNQPRTHDYARRGNPTRDVAERA
LAELEGGAGAVVTASGMGAIHLMCTALLSPGDLLLAPHDCYGGSYRLFDSLARRGAFRVV
FVDQGDAQALAQAMALRPKLVLIETPSNPLLRVVDIAAICAAAQRVGALTAVDNTFLSPA
LQQPLALGADLVLHSCTKYLNGHSDVVAGAVIAKTVEMAQELAWWGNNIGVTGAPFDCYL
LLRGLRTLAPRIALQQANALRILDWLRAQPQVTRLYHPSLPTHPGHAIAARQQRGFGAML
SFELEGDESHLRRFLKSLQLFTLAESLGGVESLISHAATMTHAGMAPEARRAAGISDSLL
RISVGIEDGDDLIADLEQAFQAAATR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgcgctatcaaccggcaactcaggcagtgcgctgtgggctgaacgacgatgagcagtat
ggcagcgtggttccccccatccatctttccaccacctacaactttaccgattttaatcag
ccgcgcacgcacgactatgctcggcgcggaaatcccacgcgcgacgtggccgagcgggcg
ctggcggagctggaggggggcgccggtgcggtggtgaccgccagtggaatgggcgcgatc
catctgatgtgtacggcgctgctctcccccggcgatctgctgctggcgccgcacgactgc
tatggcggtagctatcgcctgtttgacagcctggcgcgccggggcgctttccgggtggtc
ttcgtcgatcagggcgatgcgcaggcgctggcccaggcgatggcgctgcgcccgaagctg
gtgctgattgagacgccgagcaatccgctgctgcgggtggtggatatcgccgcgatctgc
gccgccgcgcagcgggtgggcgccctgacggcggtggataatacgtttctcagcccggcg
ctgcagcagccgctggcgctgggcgccgatctggtgctgcactcctgtaccaagtatctg
aacggccattccgacgtggtggccggcgcggtgatcgccaaaacggtggagatggcgcag
gagctggcctggtggggaaataatatcggtgtgaccggcgcgcctttcgactgctatctg
ctgctgcgggggctgcgcacgttggcgccgcgtatcgcgctgcagcaggccaatgcgctg
cgtatcctcgactggctgcgggcgcagccgcaggtcacgcggctgtatcatccgtcgctg
ccgacgcaccccggccatgccattgctgcccgccagcagcggggctttggcgccatgctc
agttttgagctagagggggatgagtcccatctacggcgtttcctaaaatccctgcaactg
tttacactggcagagtctctggggggggtggagagcctgatctcccatgccgccaccatg
acccacgccggcatggcgccggaagcgcgcagggcggcaggcattagcgacagcctgctg
cgtatttccgtgggtattgaggacggtgatgatttaatcgctgatctggaacaggcattt
caggcagcagcaacgaggtaa

DBGET integrated database retrieval system