KEGG   Edwardsiella piscicida C07-087: ETAC_16365Help
Entry
ETAC_16365        CDS       T02509                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00051  Fructose and mannose metabolism
etc00562  Inositol phosphate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
etc_M00002  Glycolysis, core module involving three-carbon compounds
etc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_16365
   00051 Fructose and mannose metabolism
    ETAC_16365
   00562 Inositol phosphate metabolism
    ETAC_16365
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etc04147]
    ETAC_16365
Enzymes [BR:etc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ETAC_16365
Exosome [BR:etc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ETAC_16365
  Exosomal proteins of bladder cancer cells
   ETAC_16365
  Exosomal proteins of melanoma cells
   ETAC_16365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM TMP-TENI
Motif
Other DBs
NCBI-ProteinID: AGH75394
Position
3704868..3705632
Genome map
AA seq 254 aa AA seqDB search
MRQPLVMGNWKLNGSRHMVHELVAALRGELSDVANCDVAIAPPAVYLDMAAHELAGSRIA
LGAQDVGINASGAFTGEISAAMLKDIGAKYIIIGHSERRTYHKEGDAFIAEKFAALKEAG
LIPVLCIGETEAENEAGKTEEVCARQLDAVLKTMGAQVFKGAVIAYEPIWAIGTGKSATP
EQAQAVHKFIRDHVAKHDAEAAQEVIIQYGGSVNAANAADLFKQPDIDGALVGGASLKAD
AFATIVRAAAAAKA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaaccattagttatgggtaactggaaactgaacggtagccgccacatggttcac
gaactggttgccgccctgcgcggtgaactgagcgacgtagcaaactgcgatgtcgccatc
gccccgccggcagtctatctggatatggccgcccatgaactggccggtagccgtatcgcc
ctcggtgcccaggacgtcggtatcaatgcctccggcgcattcaccggtgaaatctccgcc
gcgatgctgaaagacatcggtgccaaatacatcatcattggccactcagagcgccgtacc
taccacaaagaaggcgacgcgttcatcgcagagaaatttgccgcgctgaaagaagccggt
ctgatcccggtgctgtgcatcggtgagacggaagctgaaaacgaagccggtaaaacggaa
gaagtctgcgcccgccagctggatgccgtactgaaaaccatgggtgctcaggtgtttaaa
ggcgccgttatcgcctatgaaccgatatgggccatcggtaccggtaagtctgccactccg
gaacaggctcaggcggtacacaaatttatccgcgatcacgttgccaagcacgacgctgaa
gccgcacaggaagtcatcatccagtacggcggctcagtcaacgcagccaatgcggccgat
ctgttcaagcagccggacatcgacggtgcactggtcggcggggcctctctgaaggccgac
gcattcgccaccatcgtacgcgccgccgctgccgctaaagcctaa

DBGET integrated database retrieval system