KEGG   Edwardsiella piscicida C07-087: ETAC_16590Help
Entry
ETAC_16590        CDS       T02509                                 

Definition
(GenBank) DNA-binding transcriptional regulator CpxR
  KO
K07662  two-component system, OmpR family, response regulator CpxR
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc01503  Cationic antimicrobial peptide (CAMP) resistance
etc02020  Two-component system
Module
etc_M00447  CpxA-CpxR (envelope stress response) two-component regulatory system
etc_M00727  Cationic antimicrobial peptide (CAMP) resistance, N-acetylmuramoyl-L-alanine amidase AmiA and AmiC
etc_M00728  Cationic antimicrobial peptide (CAMP) resistance, envelope protein folding and degrading factors DegP and DsbA
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_16590
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ETAC_16590
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_16590
Two-component system [BR:etc02022]
 OmpR family
  CpxA-CpxR [MD:M00447]
   ETAC_16590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ AbiJ_NTD3
Motif
Other DBs
NCBI-ProteinID: AGH75439
Position
3737637..3738335
Genome map
AA seq 232 aa AA seqDB search
MNKILLVDDDRELTSLLQELLDLEGFEVIVAHDGEQALAMLDASIDLLLLDVMMPKKNGI
DTLKELRQHHQTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAILRRSNW
NEQQQNSDSGAPILQVDRLQLNPGRQEASFDGQPLELTGTEFTLLYLLAQHLGQVVSREH
LSQEVLGKRLTPFDRAIDMHISNLRRKLPERQDGQPWFKTLRGRGYLMVSVS
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaataagatattactggttgatgacgatcgcgaactgacgtcgcttctgcaagaactt
cttgatcttgaaggatttgaggttatcgtcgctcacgatggtgagcaggcattggcaatg
ctggacgccagcatcgatctgctgctactggatgtcatgatgccgaagaaaaacggtatc
gacacccttaaagagctgcgtcaacaccatcagacgccggtcattatgctcaccgcccgc
ggcagcgagctcgacagggtgctggggctggagctgggggcagacgactacctgccgaaa
cccttcaatgatcgcgagctggttgcccgtatccgggccatcctgcgccgctctaactgg
aatgagcagcagcaaaacagcgatagcggtgcgccgatcctacaggtcgatcgcctgcag
ctgaaccccggtcgccaagaggccagctttgacggccagcccctggagctcaccggtact
gaattcacgctgctgtacctgctggcgcagcatctggggcaggtggtatcgcgcgaacat
cttagccaggaggtcttgggtaagcgtctgacccccttcgatcgcgccatcgacatgcat
atctctaacctccgccgcaaactgccggagcgccaggatggccagccgtggtttaaaacg
ctgcgcgggcgcggctatctgatggtatccgtttcatga

DBGET integrated database retrieval system