KEGG   Edwardsiella piscicida C07-087: ETAC_16595Help
Entry
ETAC_16595        CDS       T02509                                 

Gene name
cpxA
Definition
(GenBank) two-component sensor protein
  KO
K07640  two-component system, OmpR family, sensor histidine kinase CpxA [EC:2.7.13.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc01503  Cationic antimicrobial peptide (CAMP) resistance
etc02020  Two-component system
Module
etc_M00447  CpxA-CpxR (envelope stress response) two-component regulatory system
etc_M00727  Cationic antimicrobial peptide (CAMP) resistance, N-acetylmuramoyl-L-alanine amidase AmiA and AmiC
etc_M00728  Cationic antimicrobial peptide (CAMP) resistance, envelope protein folding and degrading factors DegP and DsbA
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_16595 (cpxA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ETAC_16595 (cpxA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etc01001]
    ETAC_16595 (cpxA)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_16595 (cpxA)
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ETAC_16595 (cpxA)
Protein kinases [BR:etc01001]
 Histidine kinases
  OmpR family
   ETAC_16595 (cpxA)
Two-component system [BR:etc02022]
 OmpR family
  CpxA-CpxR [MD:M00447]
   ETAC_16595 (cpxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA CpxA_peri HAMP HATPase_c_2 HATPase_c_3 HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: AGH75440
Position
3738332..3739720
Genome map
AA seq 462 aa AA seqDB search
MINSLTARIFAIFWLTLALVLMVVLMLPKLDSRQITSLLDSERRQGVMLEQHVEAELAVD
PPNDLLWWRRLFRAIDKWSPPGQRLLLVTSEGRVIGAQRNEMQIVRNFIGQSDNADHPKK
KKYGRLEILGPFPIRDGEDNYQLYLIRPANSPQSDFVNLLFDRPLLLLLVTMLISSPLLL
WLAWSLASPARKLKMAADEVASGNLRQHPELESGPQEFLATGVSFNQMVSALEGMVKAQQ
RLISDISHELRTPLTRLQLATALMRRRHGEYSELARIETEALRLDSMINDLLALSRNQHK
TELEREPLRADELWSDVLDNASFEAEQRGKKLEVTAPPGPWPLFGSHSALDSAFENIVRN
ALRYSNHHIAIHFSCDGHGITIHVDDDGPGVAPQDREQIFRPFYRTDEARDRESGGTGLG
LAIVSTVVEQHHGWVRAEDSPLGGLRLTLWLPLSTRSGTGKA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatagcctgacggcgcgtatttttgccattttttggctgacgctggcgctggta
ctcatggtagtactgatgctgcccaagctcgactcacgccagataaccagtctgctggac
agtgagcggcgccagggcgtcatgctggagcagcacgtagaagccgagctggccgtcgac
ccccccaacgatctgctgtggtggcggcgcctctttcgcgccatcgataaatggtctcct
ccggggcagcgtctgctgctggtgaccagtgaaggacgggtgatcggggcccagcgcaac
gaaatgcaaatcgtgcgtaactttatcggccagtccgacaatgccgatcaccctaagaag
aaaaagtatgggcgcctagagatccttggcccctttccgatccgcgacggcgaggacaac
tatcagctgtatctgatccggcccgctaacagcccgcagtccgactttgtaaacctgcta
ttcgatcgcccgctgctgctgctgctcgtcaccatgctgatcagttcaccgctgctgctg
tggctggcgtggagcctggccagcccggcgcgtaagctgaaaatggcggcggacgaggtc
gccagcggaaacctgcgtcagcaccctgagctggagtcgggaccacaggagtttttagcc
accggggtcagcttcaaccagatggtcagcgccctggaggggatggtgaaggcgcagcag
cgtctgatctccgatatctctcacgagctgcgtacgccgttaacccggctacagctggcc
acggcactgatgcggcggcgccacggcgagtacagcgagctggcgcgtattgaaaccgag
gctctgcggctggacagcatgatcaacgatctgctggcgctgtcgcgtaaccagcataaa
accgagctggagcgggagcccctacgggcagatgagctgtggtctgatgtattggataac
gccagcttcgaagccgaacagcgcggcaaaaagctggaggtaaccgccccacccggacca
tggccactgtttggcagccactcggcgctggacagcgcgttcgagaatatcgtacgcaac
gccctgcgctactccaaccaccatatcgctatccacttcagctgtgatggacacgggatc
accatccacgtagacgatgacggtccaggcgtcgccccccaggatcgtgaacagatcttc
cgcccgttctatcgcaccgatgaggcgcgcgatcgcgaatccggcggcaccgggctggga
ttggcgatcgtctctacggtggtggaacagcaccatggctgggtacgggccgaggacagc
ccgctgggcggtctacgcctgacgctgtggctaccgctctccacgcgcagcggcacgggc
aaagcctga

DBGET integrated database retrieval system