KEGG   Edwardsiella piscicida C07-087: ETAC_16720Help
Entry
ETAC_16720        CDS       T02509                                 

Definition
(GenBank) argininosuccinate lyase
  KO
K01755  argininosuccinate lyase [EC:4.3.2.1]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00220  Arginine biosynthesis
etc00250  Alanine, aspartate and glutamate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Module
etc_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ETAC_16720
   00220 Arginine biosynthesis
    ETAC_16720
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etc04147]
    ETAC_16720
Enzymes [BR:etc01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     ETAC_16720
Exosome [BR:etc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ETAC_16720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 ASL_C2
Motif
Other DBs
NCBI-ProteinID: AGH75465
Position
complement(3768680..3770062)
Genome map
AA seq 460 aa AA seqDB search
MALWGGRFSQAADRRFKQFNDSLRFDYRLAEQDIIGSVAWSRALVTVGVLTVQEQQQLAQ
ALAALLEEVRADPHAILDSDAEDIHSWVEQQLIGRVGDLGKKLHTGRSRNDQVATDLKLW
CKAQGEMLRQALIVLQQALTDCARQNQDAVMPGYTHLQRAQPITFAHWCLAYVEMLARDE
SRLDDALRRLNTSPLGSGALAGTAYPIDRDRLADWLGFSAATRNSLDSVSDRDHVLELLS
AAAIGMVHLSRFAEDLIFFNSGEAGFIELSERVTSGSSLMPQKKNPDALELIRGKCGRVQ
GALSGMLMTLKGLPLAYNKDMQEDKEGLFDALDTWLDCLQMAALALDGLAVRRPRCAEAA
QQGYANATELADYLVAKGIPFREAHHIVGEAVVAALAQGKPLEALPLETLQSFSPAIGAD
VYPLLALDSCLVKRSARGGVAPQQVAQAIDDAQRRLGNIL
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggcactttggggcgggcgtttttcccaggcggcagatcgtcgttttaaacagtttaat
gattccctgcgctttgactatcggctggcggagcaggatatcatcgggtccgtcgcctgg
tcccgggcgctggtgaccgtcggcgtactgacggtacaggagcagcagcagctggcgcag
gcgctcgcggcgctgttggaggaggtccgcgccgatccccacgctattctggacagcgat
gcggaggatattcacagctgggtggagcagcagctgattgggcgggtcggcgacctgggc
aaaaagctgcataccgggcgcagccgcaacgatcaggtggcgaccgatctgaagctatgg
tgcaaggcgcagggcgagatgctgcgccaggcgctgatagtgctgcagcaggcgctgacg
gattgcgcccgccagaatcaggatgcggtgatgcccggctatacccatttgcagcgggcg
cagccgatcacctttgcccattggtgtctggcctatgtcgagatgctggcccgtgatgag
agccgactggatgatgccctgcggcgtctgaataccagcccgctgggcagcggcgcactg
gccggtaccgcctatcctatcgatcgcgatcggctggccgactggctggggttctctgcc
gcaacccgtaatagcctggacagcgtatccgatcgcgatcatgtcctggagctgctgtcg
gcggccgccatcggcatggtgcatctgtcgcgcttcgccgaggatctgatcttctttaac
agcggagaagccggctttatcgagctatcggagcgggtcacctccggatcgtcgctgatg
ccgcagaaaaagaacccggatgcgctggagctgatccgcggtaagtgtggacgggtgcag
ggggcgctcagcggcatgctgatgacgttaaaagggcttccgctggcctacaataaggat
atgcaggaagacaaagaggggctgtttgatgccctggacacctggctggactgtttacag
atggcggcgctggcgctggatggattggcggtgaggcgcccgcgctgtgccgaagcggcg
cagcagggatacgcgaatgccacggagctggcggattatctggtggccaaagggatcccg
tttagggaggcgcatcatattgtcggagaggcggtcgtggccgcgttggcgcagggtaaa
ccgctggaggcgctgccgctggagacgctgcagtcattcagcccggcgatcggcgccgat
gtctatccgctgctggcgctggactcctgtctggtaaaacgcagcgcccgcggcggcgta
gcgccgcagcaggtcgcacaggcgattgatgatgcccagcggcggctgggtaacattctc
tga

DBGET integrated database retrieval system