KEGG   Edwardsiella piscicida C07-087: ETAC_16725Help
Entry
ETAC_16725        CDS       T02509                                 

Definition
(GenBank) argininosuccinate synthase
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00220  Arginine biosynthesis
etc00250  Alanine, aspartate and glutamate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Module
etc_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ETAC_16725
   00220 Arginine biosynthesis
    ETAC_16725
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etc04147]
    ETAC_16725
Enzymes [BR:etc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     ETAC_16725
Exosome [BR:etc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ETAC_16725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginosuc_synth
Motif
Other DBs
NCBI-ProteinID: AGH75466
Position
complement(3770134..3771351)
Genome map
AA seq 405 aa AA seqDB search
MATQSISKIVLAYSGGLDTSAIIPWLKENYGDCEVIAFVADIGQEREDLVGIEQKALRSG
ATSCYVVDLRETFIKDYVYPVLKSGALYEGSYLLGTSMARPLIAKAQVELALTLGADALC
HGATGKGNDQVRFETTYTALAPQLQVVAPWREWDLRSREALLDYLKGRDIPTTATLEKIY
SRDANAWHISTEGGVLESPWSPANQDCWVWTCAPEEAPDQPELVTVGVEKGEVVSVNGVA
MTPFGCLQALNALGARHGVGRIDIVENRLVGIKSRGCYETPGGTIMMAALRGVEQLVLDR
DSFQWREKLGQEMSYVVYDGRWFAPLRQSLQAAADALAEAVSGEVVIKLYKGQATAIQKT
SANSLYNEAFATFGEDDVYDHSHAGGFIRLFSLSSRIRALNSAKQ
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcaacccaaagcatcagcaaaatcgttctggcctactccggcggcctggatacctcc
gccatcattccgtggcttaaggaaaactacggcgactgtgaggttatcgcctttgtggcg
gacatcggccaggagcgtgaagatctggtgggcatcgagcagaaagcgctccgctctggc
gccacctcctgctatgtcgtggatctgcgcgaaacctttatcaaggattacgtctatccg
gtgctgaagagcggcgcgctctatgagggcagctatctgctggggacgtcgatggcccgc
ccgctgatcgcgaaggcgcaggttgagctggcgctgacgctgggggccgacgccctgtgc
cacggcgcgaccgggaaaggcaacgatcaggtgcgctttgaaaccacttataccgcgctg
gcgccgcagttgcaggtcgtggcgccgtggcgtgagtgggatctgcgttcgcgtgaggcg
ctgctcgactatctgaaggggcgcgatatccccaccaccgcaacgctggagaagatctac
agccgtgacgccaatgcctggcatatctctaccgaggggggcgtactggagagcccgtgg
agcccggccaaccaagactgctgggtgtggacctgtgctcccgaggaggcgccggatcag
ccagagctggtgaccgtgggcgtggagaagggtgaggtcgtttcggtcaacggggtggcg
atgacgccctttggctgcctgcaggcgctgaatgcgctgggcgcccgccacggcgtaggg
cgtattgatatcgtcgaaaaccgcctggtgggcattaaatcgcgcggctgctatgagacg
ccggggggcaccatcatgatggcggcgctgcgcggcgtggagcagctcgtactggatcgc
gacagcttccagtggcgtgagaagctgggccaggagatgtcctacgtcgtgtacgacggc
cgctggttcgcgccgctgcgtcagtcgctgcaggcggcggccgatgcgttggccgaggcg
gtgagcggcgaggtggtgatcaagctgtataaagggcaggctaccgccattcagaagacg
tcggccaacagtctgtataacgaagctttcgccacctttggtgaggatgatgtgtacgat
cacagccacgccggcggctttattcgcctgttctccctctcttcgcgcattcgtgcgctg
aacagcgcaaagcagtag

DBGET integrated database retrieval system