KEGG   Edwardsiella piscicida C07-087: ETAC_16730Help
Entry
ETAC_16730        CDS       T02509                                 

Definition
(GenBank) acetylglutamate kinase
  KO
K00930  acetylglutamate kinase [EC:2.7.2.8]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00220  Arginine biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01210  2-Oxocarboxylic acid metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    ETAC_16730
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.8  acetylglutamate kinase
     ETAC_16730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: AGH75467
Position
complement(3771390..3772163)
Genome map
AA seq 257 aa AA seqDB search
MDPLIIKLGGVLLDNPQAMERLFQALLAYRHHDRRPIVIVHGGGCLVDELMARLQLPVVK
RQGLRVTPADQIGIISGALAGTANKTLQACAVAHGLAAIGLSLADGGAVQVSQLDASLGH
VGQAQPGSPRLLRQLLAADFLPIVSSIGISADGMLLNVNADQAATALAATLGADLLMLSD
VSGILDGKGQRIAEMTAQKAQRLIEQGIITDGMVVKVNAALEAARTLGRPVDIAGWRHAE
KLPALFNGEAVGTRIHA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggatccgttaatcatcaaactcggcggcgtattactcgataacccacaggcgatggag
cgtttatttcaggcgttgctggcctaccgacatcacgatcgccgtccgatcgtcatcgta
cacggcggcgggtgtctggtggatgagctgatggcgcgcctgcagctgccggtggtgaag
cggcagggtctgcgagtcacgccggccgaccagataggcatcatcagcggtgcgctggcg
gggacggcgaacaagacgctacaggcctgcgctgttgcgcacgggttggcggcgatcggc
ctgtcgctggccgacggcggggcggtgcaggtgagtcagttggatgcgtctctggggcac
gttggccaggcgcagccgggatcgccgaggctgctgcgtcagctgctggcggcggacttt
ctgccgatcgtcagctccatcggcatcagcgctgacgggatgttattgaatgttaatgcc
gaccaggcggcgacggcgctggcggcgaccctgggcgcggatctgctgatgctgtctgac
gtcagcggcatcctcgatggtaagggacagcgcattgcggagatgacggcgcagaaggcg
cagcgcctgatcgagcagggcatcatcaccgatgggatggtggtaaaggtgaatgcggcc
ttggaagccgcacggacgctggggcgcccggtggatatcgccggttggcgtcacgccgaa
aagctgccggcgctgtttaacggcgaagccgtcggcacgcgtattcatgcataa

DBGET integrated database retrieval system