KEGG   Edwardsiella piscicida C07-087: ETAC_16735Help
Entry
ETAC_16735        CDS       T02509                                 

Gene name
argC
Definition
(GenBank) N-acetyl-gamma-glutamyl-phosphate reductase
  KO
K00145  N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00220  Arginine biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01210  2-Oxocarboxylic acid metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    ETAC_16735 (argC)
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     ETAC_16735 (argC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dh Semialdhyde_dhC Epimerase
Motif
Other DBs
NCBI-ProteinID: AGH75468
Position
complement(3772193..3773215)
Genome map
AA seq 340 aa AA seqDB search
MSSIQRPLNGLIVGASGYTGAELAAYLQRHPHITIAGLTVSAQSVDGGKLLSDIHPRLKG
VVDLPLIASDDSAALADLADVVFLATDHAVSHLLAPKFLAAGCTVFDLSGAYRLRCSKVY
PQYYGFTHQHSEWLEQAVYGLAEWQGDQLRAAQLIALPGCYPTAALLALKPLLDAGLIDT
AQWPVINAVSGVSGAGRKASLGSSFCEVSLQPYGLFTHRHQPEIATHLGIPVIFTPHLGN
FPRGILETIHLRVKRGVDAAEVATAFYRAYQDKPLIRLCQGSLPSIGAVAGTPFCDIGFS
LQGQHLIVVAAEDNLLKGAAAQAVQCMNLRFGFHETCALL
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtattcagaggccgttaaatgggttaatcgttggcgccagcggctataccggt
gctgagctcgccgcttatctgcagcgccatccccacatcaccatagcgggtttgaccgtg
tctgcgcaaagcgttgatggcggaaaattgttgtcagatattcacccgcggctgaaaggg
gtggtcgatctcccgttgattgccagcgacgacagtgcggcgctggccgatctggccgat
gtggtctttctggcgaccgatcatgcggttagccatcttctggcgcctaagtttctggcg
gccgggtgcaccgtgttcgatctctccggcgcctatcggctccgctgcagcaaggtctac
ccgcagtattacggctttacgcatcaacactcagagtggcttgagcaggccgtatatggt
ttggcggagtggcagggcgatcagctgcgcgcggcgcagctgatcgccctaccggggtgc
tacccaacggcggcgctgctggcgttaaaaccgctgctggatgctgggcttatcgatacg
gcgcagtggccggttatcaacgccgtcagcggcgttagcggcgccgggcgtaaggccagc
ctcggcagcagcttttgcgaggtgagcctgcagccctatgggctgtttactcatcgtcat
cagccggagatcgccacgcatctgggcattccggtgatttttaccccccacttaggcaat
tttcctcgcggcatactggagacgatccatctgcgggtaaaacgcggcgtggatgcggcc
gaggtggcgacggctttttatcgggcctaccaagataagcctttgatccgcctgtgtcag
ggatcgctgccgtccatcggcgcggtggcgggtacgccgttttgcgacatcggcttctcc
ctgcaggggcagcatctgatcgtggttgccgcagaggacaatctgctgaaaggggcggcg
gcccaggcggtgcagtgtatgaacctgcgctttggctttcatgagacgtgcgctcttctt
taa

DBGET integrated database retrieval system