KEGG   Edwardsiella piscicida C07-087: ETAC_16740Help
Entry
ETAC_16740        CDS       T02509                                 

Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00220  Arginine biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01210  2-Oxocarboxylic acid metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    ETAC_16740
Enzymes [BR:etc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     ETAC_16740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: AGH75469
Position
3773419..3774570
Genome map
AA seq 383 aa AA seqDB search
MNTQLPSFIALYRALIATPSISANDGALDQSNERLITLLAGWLSDLGLRVEVQPIPNTRN
KFNLLASYGEGSGGLMLAGHTDTVPFDEGRWTRDPFTLSEQDNRLYGLGTADMKGFFAFI
IDTLRDIELHKLNKPLYILATADEETSMAGARYFAASTALRPDCCIIGEPTSLKPIRAHK
GHLSEAIRITGQSGHSSDPARGVNAIEIMHDAIGHLLTLRNTLQQRYHNPAFNIPYPTMN
LGHIHGGDAANRICACCELHLDMRPLPGMTLNDLSELLNQALAPIATQWPGRLRIEHLHP
PIPGYECPRHAPLVQAIEQLLGERAEVVNYCTEAPFLQEICPTLVLGPGSIEQAHQPDEY
LSTDFIVPTRTLLTQIIHHFCQR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgcaattaccctcatttatcgcgttgtaccgtgcgctgatcgcaaccccctcc
atcagcgccaacgacggcgcactggatcagagcaatgaacggttaatcacgctgctggca
ggatggctgagcgatctcgggctgcgtgttgaggtacagccaatacctaatacacggaat
aaattcaatttattggcgagctatggcgagggatccggcggactgatgctggcggggcac
accgatacggtcccctttgacgagggacgctggacccgagatcccttcaccctcagcgaa
caagataatcgcctgtacggtcttggcaccgcagacatgaaaggattcttcgcttttatc
atcgataccctacgcgatatcgaactgcataaactgaataaaccgctctacattttggcg
acggcggatgaggagacctcgatggcgggcgcgcgctattttgccgccagcaccgcgcta
cgccccgactgctgcatcatcggcgagcccacctcccttaagccgatccgggcccataaa
ggccatctctccgaggccatccgcatcaccggtcagtcaggacactccagcgatccggcg
cgcggcgttaacgcgattgagatcatgcacgatgccatcggccacctgctcaccctgcgc
aatacgctgcagcagcgttaccacaatccggcctttaatatcccttaccccaccatgaac
ctagggcatatccacgggggcgatgcggccaaccgcatctgcgcctgctgcgaactgcac
ctggatatgcgcccgctgccgggaatgacgctgaacgatctcagcgagctgctgaaccag
gcgctggcgcccatcgcgacgcagtggccgggacgtctgcgtattgagcacctgcatccg
ccgatccccggctatgaatgtccgcgccacgcgccgctggtacaggcaatagaacagctc
ttgggggaacgagcagaggtcgtcaactactgtaccgaggcgccgttcctgcaagagatc
tgcccaacgctggtactcggcccaggctccattgagcaggcgcaccagccggatgagtat
ctgtccaccgactttattgtgccgacgcgcaccctgctaacgcagataatccaccatttt
tgtcagcgctga

DBGET integrated database retrieval system