KEGG   Edwardsiella piscicida C07-087: ETAC_16750Help
Entry
ETAC_16750        CDS       T02509                                 

Gene name
metF
Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00670  One carbon pool by folate
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ETAC_16750 (metF)
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     ETAC_16750 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AGH75471
Position
complement(3777488..3778387)
Genome map
AA seq 299 aa AA seqDB search
MSFFHASQHDALNQSLAELQGRIQVSFEFFPPRSQEMEQTLWRSIDRLSTLRPSFISVTY
GANSGERDRTHGVIKGIKERTGLEAAPHLTCVDVSREALRGIARDYWNSGIRHIVALRGD
LPAEGGRPEMYASDLVALLREEADFDISVAAYPEVHPEAKSAQADLLNLKRKIDAGASRA
ITQFFFDVESYLRFRDRCAAAGIDAEIVPGILPVSNFRQLQRFAALTNVRVPQWMLAMFD
GLDADAETRKLVGANIAMDMVKLLSREGVKDFHFYTLNRAELSYAICHTLGVRPQGSVA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagtttttttcacgcaagccagcatgatgcgctaaaccagagcctggccgagctgcag
gggcggatccaggtgtcctttgagttttttccgccgcgcagccaggaaatggagcaaacg
ctgtggcgatccatcgatcggctcagcaccctgaggccgtcgttcatctcggtgacctac
ggcgctaactctggcgagcgcgaccgtacccacggcgtgattaagggaataaaagagcgt
actgggctggaggcggcgccgcacctgacctgcgttgatgtcagccgggaggcgctgcgg
ggaatcgctcgagattactggaatagcggtatccgccatattgttgcgctgcgcggcgat
ctgccggcggagggcgggcgtcctgaaatgtacgccagcgatttggtggcgctgctgcgc
gaggaggctgactttgatatttcggtcgccgcctatccggaggtccacccggaggccaag
agcgcccaggccgacctgctaaacctaaagcgtaagatcgacgctggcgccagtcgggca
atcacccagtttttctttgacgtggagagctatctgcgctttcgcgatcgctgtgcggcg
gccggcattgacgcggagattgtgccggggatcctgccggtgtccaactttcgccagctg
cagcgctttgccgcgctgaccaatgtccgcgtgccgcagtggatgctggccatgtttgac
gggctggatgcggatgcggagacgcgcaagctggtcggcgccaacattgcgatggacatg
gtgaaactgctcagccgcgagggggtgaaagacttccatttttataccctgaatcgagcc
gagctgagctacgccatttgccatacgctgggcgtgcggccgcaggggagcgtggcgtga

DBGET integrated database retrieval system