KEGG   Edwardsiella piscicida C07-087: ETAC_16795Help
Entry
ETAC_16795        CDS       T02509                                 

Gene name
glnL
Definition
(GenBank) nitrogen regulation protein NR(II)
  KO
K07708  two-component system, NtrC family, nitrogen regulation sensor histidine kinase GlnL [EC:2.7.13.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00497  GlnL-GlnG (nitrogen regulation) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_16795 (glnL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etc01001]
    ETAC_16795 (glnL)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_16795 (glnL)
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ETAC_16795 (glnL)
Protein kinases [BR:etc01001]
 Histidine kinases
  NtrC family
   ETAC_16795 (glnL)
Two-component system [BR:etc02022]
 NtrC family
  GlnL-GlnG [MD:M00497]
   ETAC_16795 (glnL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA PAS_4 PAS PAS_8 PAS_9 HATPase_c_3 DUF1688
Motif
Other DBs
NCBI-ProteinID: AGH75480
Position
3787484..3788551
Genome map
AA seq 355 aa AA seqDB search
MAEHPTPPHRDLPDAGPLLNALMTCILVLDDDLVIRYANPAAQQLLAQSPRKLFGTPLPD
LLSYLSLDIAMMRISLHAGQGFTDNEVMLVVDSQPHIMALTAQPLSEGQILLELSTLDSQ
RRLSQEQLQHSQQVAARDLVRGLAHEIKNPLGGLRGAAQLLARALPDPALTEYTQVIIEQ
ADRLRNLVDRLLGPQRPGQRVTQSIHQVAERVCQLVTLECPGNITLLRDYDPSLPELNHD
PEQIEQVLLNITRNALQALGEQGGTITLRTRTALQVTLHGERYRLAARIDIEDDGPGIPA
QLQDTLFYPMVSGRSGGTGLGLSIARSLIDQHQGKIEFNSWPGHTEFSVYLPIRK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacaccctacgccgccccaccgtgacttacccgatgccggaccgctgctgaat
gccctgatgacctgcatcctggttctggacgacgatctggtcattcgctatgccaatccg
gccgcgcagcagctgctggcgcagagtccgcgcaagctgtttggcacaccgctgccggat
ctgctgagctatctctccctggatatcgcgatgatgcgcatcagcctgcacgccgggcag
ggttttaccgacaacgaggtgatgctggtcgtcgacagccagccgcacatcatggcgctg
acggcccagcccctgagcgaagggcagatcctgctggagctttcaaccctggacagccag
cgtcgcctgagccaggagcagctccagcactcccagcaggtcgccgcccgcgatctggtg
cgcgggctggcccatgagatcaagaaccccctaggcgggctacgcggggcagcgcagctg
ttggccagggcattaccggatccggccctgaccgaatacactcaggtgatcattgagcag
gccgatcgcctgcgcaacctggtcgatcgtctgctgggcccccagagaccggggcagcgc
gtcacccagagcattcatcaggtcgccgagcgggtctgtcagctggtcaccctggagtgc
ccggggaacatcaccctgctgcgcgactatgatcccagcctgccggagctgaatcacgat
ccggagcagatagagcaggtgctgctgaacatcacgcggaacgccctgcaggcgctgggt
gaacagggtggcaccatcaccctgcgtacccgtaccgcgctacaggtcaccctgcacggc
gagcgctatcgcctggcggcgcgcatagacattgaagacgatgggccagggatccccgcc
cagctgcaggatacgctgttctacccgatggtgagcggacgcagcggaggcaccgggctt
ggcctgtcgattgcaaggagcctgatcgatcagcatcagggcaaaatcgagtttaacagc
tggccgggccacaccgagttttcggtgtatttgccaatccgcaaatag

DBGET integrated database retrieval system