KEGG   Edwardsiella piscicida C07-087: ETAC_16800Help
Entry
ETAC_16800        CDS       T02509                                 

Gene name
glnG
Definition
(GenBank) nitrogen regulation protein NR(I)
  KO
K07712  two-component system, NtrC family, nitrogen regulation response regulator GlnG
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00497  GlnL-GlnG (nitrogen regulation) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_16800 (glnG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_16800 (glnG)
Two-component system [BR:etc02022]
 NtrC family
  GlnL-GlnG [MD:M00497]
   ETAC_16800 (glnG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_activat Response_reg Sigma54_activ_2 HTH_8 AAA_5 AAA_2 AAA Mg_chelatase AAA_7 AAA_16 FleQ MCM TIP49
Motif
Other DBs
NCBI-ProteinID: AGH75481
Position
3788589..3790004
Genome map
AA seq 471 aa AA seqDB search
MQPGLVWIVDDDSAIRWVLERALTGAGLRCATFENGQAVLTAMSAQTPDVLLSDIRMPGM
DGLALLQQIKVRHPLLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAIS
HYQEQQQPARQVPGSDPSADIIGEAAAMQDVFRIIGRLSRSSISVLINGESGTGKELVAH
ALHRHSPRAKAPFIALNMAAIPRDLIESELFGHEKGAFTGASQIRQGRFEQADGGTLFLD
EIGDMPLDVQTRLLRVLADGQFYRIGGYAPVRVDVRIIAATHQNLEQRVQEGMFREDLFH
RLNVIRVHLPPLRERREDIPRLARHFLKVAAQELGVEAKVLSPEAEAALTRLPWPGNVRQ
LENTCRWLTVMAAGQEVLTQDLPAELFDSARDERQPAALSPDSWPRLLSQWAEHALQSGQ
QDLLAEALPEMERTLLNCALRHTQGHKQEAARLLGWGRNTLTRKLKELGME
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgggtctcgtctggatagtcgacgacgacagtgccatccgctgggtcttagag
cgcgcgctgaccggcgcaggtttgcgctgtgccacgtttgaaaatggtcaggcggtgctg
acggcgatgagcgctcagacgccggacgttttgctgtcagacatccgtatgcccggtatg
gacggactggcgctgctgcagcagataaaagtacgtcatccgctgctgccggtcatcatt
atgacggcccactccgatctggatgccgcggtcagcgcctaccagcagggcgcctttgat
tatctgcccaagccgttcgatattgacgaagccgtcgcgctcgtcgaacgcgccatcagc
cactatcaggagcagcagcagcccgcgcgccaggtgccggggagcgatcccagcgccgat
atcatcggagaggcggcggcgatgcaggatgtctttcgcattatcggacgcctgtcacgc
tcctccatcagcgtgctgatcaatggggagtcgggcaccgggaaagagctggtcgcccat
gcgctgcaccgccacagcccgcgcgccaaggcgccgtttatcgccctgaatatggcggcg
attccacgcgatctgatcgaatccgagctgttcggccatgaaaaaggcgcctttaccggc
gccagccagatccgccaggggcgctttgagcaggcggacggcgggacactgtttctcgat
gaaatcggcgacatgccgctggacgttcagacccgcctgctgcgcgtgctggccgacgga
cagttttatcgcatcggcggctatgcgccggtcagggtcgatgtacgcatcatcgccgcc
acccaccagaatctggagcagcgggtgcaagaggggatgttccgcgaagatctcttccac
cgccttaacgtgatccgcgtgcatcttccgccgctgcgtgagcggcgcgaggatattccg
cgtctagcccgccactttctcaaagtggcggcgcaggagctgggcgtcgaggccaaagtg
ctcagcccggaggccgaggcggcgctgacccgtctgccgtggcctggcaacgttcgccag
ctggagaatacctgccgctggctgacggttatggccgcaggccaagaggtgttgacgcag
gatctgccggcggagctgtttgacagcgcgcgcgatgagcgtcagccggcggcgctttcg
ccggacagctggccacggctgctgagccagtgggcggagcatgccctgcagagcggccag
caggatctgctggcggaagccctgccggaaatggagcgtacgctgctgaactgtgccctg
cgccacacccagggccataagcaagaggcagccaggctgctgggatggggccgcaatacc
ctgacccgcaagctgaaagagctgggaatggagtaa

DBGET integrated database retrieval system