KEGG   Edwardsiella piscicida C07-087: ETAC_16885Help
Entry
ETAC_16885        CDS       T02509                                 

Definition
(GenBank) D-ribose transporter subunit RbsB
  KO
K10439  ribose transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
etc02030  Bacterial chemotaxis
Module
etc_M00212  Ribose transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_16885
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    ETAC_16885
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_16885
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212]
    ETAC_16885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Peripla_BP_3 Peripla_BP_6 ABC_sub_bind ATPgrasp_N PucR
Motif
Other DBs
NCBI-ProteinID: AGH75498
Position
complement(3813498..3814385)
Genome map
AA seq 295 aa AA seqDB search
MNMKKLATLISAAALSATLSANAMAQDTIALVVSTLNNPFFVSMKDGAQKEANKLGYKLV
VLDSQNNPAKELANVQDLTVRGAKLMLINPTDSDAVGNAVKMANQANIPVITLDRAASQG
SVVSHIASDNVAGGKLAGDFIAQKLGAGAKIIQLEGIAGTSAARERGEGFKQAVVAYKFD
VLASQPADFDRTKGLNVMQNLLTAHPQVQAVFAQNDEMALGALRALQTAGRGDVLVVGFD
GTQDGEKAVQSGKLGATVAQQPEQIGVIGVETADKVIKGEKVPANIPVELKLVTK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgaaaaaactggcaaccctgatctccgccgcggccctgagcgccactctgagc
gccaacgccatggcgcaggacaccattgccctggtggtctctactctgaataacccgttc
tttgtgtcgatgaaggatggcgcgcagaaagaggccaacaagctgggatacaagctggtg
gtattggattcacagaacaacccggccaaagagctggccaacgtacaggatctgaccgtg
cgcggcgctaagctgatgctgattaacccgacggactctgatgcggtgggtaacgcggta
aaaatggccaatcaggccaatatcccggtgatcacccttgaccgtgcggccagccaaggt
agcgtggttagccatatcgcctctgataacgtcgctggcggcaagctggccggggacttt
attgcccagaagctgggggccggcgctaagatcatccagctggaggggatcgctggaacc
tcggccgcccgtgagcgtggcgaaggctttaaacaggcggtcgtcgcctataagtttgac
gtactggccagccagccagccgactttgaccgtactaagggtttgaacgtcatgcagaac
ctgctcacggcgcacccgcaggttcaggccgtgttcgcgcagaatgatgaaatggcgctc
ggcgcgctgcgcgcgctgcagacggcgggccgcggcgatgtgctggtcgtgggctttgat
ggaacccaagacggtgaaaaagccgtacagagcggtaagctgggggccaccgtcgcgcag
cagcctgagcagatcggcgtgatcggcgtcgagaccgcggataaggtcatcaaaggggaa
aaagtgccggcaaacattccggttgagctgaagctggtcaccaagtaa

DBGET integrated database retrieval system