KEGG   Edwardsiella piscicida C07-087: ETAC_16890Help
Entry
ETAC_16890        CDS       T02509                                 

Gene name
rbsC
Definition
(GenBank) ribose ABC transporter permease protein
  KO
K10440  ribose transport system permease protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00212  Ribose transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_16890 (rbsC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_16890 (rbsC)
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212]
    ETAC_16890 (rbsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-ProteinID: AGH75499
Position
complement(3814409..3815389)
Genome map
AA seq 326 aa AA seqDB search
MNTQVTANQGGFSKARLKVWLVEQKSLIALLVLIAVVSSMSPNFFTVNNLFNILQQTSVN
AIMAVGMTLVILTSGIDLSVGSLLALTGAVAASIVGMDVNALVAVGAALALGAAIGGCTG
VIVAKGKVQAFIATLVMMLLLRGVTMVYTDGSPVNTGFSAQADLFGWFGIGRPLGMPTPI
WLMIVVFALAWYMLHHTRLGRYIYALGGNEAATRLSGISVDRVKIAVYALCGLLSALAGV
IEVARLSSAQPTAGTGYELDAIAAVVLGGTSLAGGKGRIMGTLIGALILGFLNNGLNLLG
VSSYYQMIVKAAVILLAVLVDNKSNK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaatacccaagtaactgcaaaccagggcggattcagcaaggcccgactcaaggtctgg
ctggtcgagcagaaatcgctgatcgccctgctggtgctgatcgcggtggtctcctccatg
agccccaatttcttcaccgtcaataatctgttcaacattctgcagcagacctccgtgaac
gccatcatggccgtcgggatgacgctggtgatcctgacctccggcatcgatctgtccgta
gggtcgctgctggcgctgaccggcgcggtcgcggcgtctattgtcgggatggatgtgaat
gcgctggtggcggttggcgcggcgctggcgctgggagccgcgattggcggctgcaccggc
gttatcgtggccaagggtaaggttcaggccttcattgcgaccctggtgatgatgctgctg
ctgcgcggggttacgatggtgtataccgacggcagtccggtcaataccgggttttctgcg
caggcggatctgtttggctggtttggtatcggccgtccactggggatgccgacgcccatc
tggctgatgattgtggtctttgcgctggcgtggtacatgctgcaccacacccgcctcggg
cgctatatctacgcgctgggggggaacgaggcggcaacgcgcctgtccgggatcagcgtc
gatcgcgtcaagattgcggtgtatgccctgtgcggcttgctgtcagcgctggccggcgtg
atagaggtcgcccggctctcctcggcgcagccgacggccggcaccggctatgagctggat
gcgatcgcggcggtggtgctgggtgggaccagcctggccggcggtaaagggcggattatg
ggaacgctgatcggtgccctgatccttggcttcctgaataacggcctaaacttactcggt
gtttcctcctactaccaaatgatcgtcaaggcagcggtgattctgttggcggttttggta
gacaacaaaagcaataaataa

DBGET integrated database retrieval system