KEGG   Edwardsiella piscicida C07-087: ETAC_16895Help
Entry
ETAC_16895        CDS       T02509                                 

Definition
(GenBank) D-ribose transporter ATP binding protein
  KO
K10441  ribose transport system ATP-binding protein [EC:3.6.3.17]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00212  Ribose transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_16895
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_16895
Enzymes [BR:etc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     ETAC_16895
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212]
    ETAC_16895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_30 RsgA_GTPase MMR_HSR1 Ploopntkinase3 AAA_29 AAA_22 ABC_ATPase MukB AAA_15 AAA_23 Rad17 DUF2813
Motif
Other DBs
NCBI-ProteinID: AGH75500
Position
complement(3815396..3816901)
Genome map
AA seq 501 aa AA seqDB search
MQPLLALTAIDKSFPGVKALSGASLNVYPGRVMALVGENGAGKSTMMKVLTGIYQKDAGS
LHYLGKETAFNGPKSSQEAGIGIIHQELNLIPQLTIAENIFLGREFTHRLGRIDWKKMYA
EADRLLARLNLDYGSRRLVGDLSIGEQQMVEIAKVLSFESRVIIMDEPTDALTDTETESL
FSVIRELKAQGRGIVYISHRLKEIFEICDDVTVFRDGQFIAERPVSGLCEDSLIEMMVGR
KLEEQYPRLDKAPGDLRLQVSHLSGPGVRDVSFTLRSGEILGVSGLMGAGRSELMKILYG
ALPRTQGSITLEGNPIQTRSPQEGMANGIVYISEDRKRDGLVLGMSVKENMSLTALRYFS
RLNGSLKHGEEREAVGDFISLFNIKTPSMDQAIGLLSGGNQQKVAIARGLMTRPKVLILD
EPTRGVDVGAKKEIYQLINQFKAEGLSIILVSSEMPEVLGMSDRILVMHDGQLSGEFPIA
QATQEVLMAAAVGKQYGVKQE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgttactggctttaaccgcaatcgataaatcgtttcccggcgtgaaggcgctg
tccggcgcctcgttgaatgtctatcccggacgggtgatggcgctggtcggggagaacggc
gccggcaaatctaccatgatgaaagtgctgaccgggatctatcagaaagatgccggttct
ctgcattacctgggtaaagagacggcgtttaacggtcccaagtcttcgcaggaggccggc
attggtattattcatcaggagctgaacctgatcccgcagctgactatcgctgaaaatatc
tttttgggccgtgagtttacccatcgtctggggcgcattgactggaaaaaaatgtatgcc
gaggcggacaggctgctggcgcgtttgaatctggattacggcagccgccgcctggtcggc
gatctgtccatcggcgaacagcagatggtagagatagccaaggtgctgagcttcgagtcg
cgggtcatcatcatggatgagccgaccgatgcgctgacggataccgagacggagtccctg
ttcagcgtcatccgtgagctgaaagcgcagggacgcggcattgtttatatctcgcaccgt
ctgaaggaaatctttgaaatctgcgatgacgtgaccgtcttccgcgacgggcagtttatc
gcagagcggcccgtcagtgggctctgcgaagactcgctgattgaaatgatggttgggcgc
aagctggaggagcagtatccgcgccttgataaggcgcccggcgatctgcgcctgcaggtc
agtcacctatcaggccctggcgtcagggatgtctcttttacgctgcgcagcggtgaaatt
ctgggggtgtctggcctgatgggcgcggggcgcagtgagctgatgaagatcctgtacggc
gcgctgccgcgtacccaggggagtatcactctggagggaaaccctattcagacgcgctct
ccgcaggaggggatggccaacggcatcgtctatatctctgaagaccgaaagcgcgatggc
ctggtgctggggatgtcggtgaaggagaacatgtcactgacggcgctgcgctacttcagt
cgccttaacggctcgctcaagcatggcgaagagcgggaggccgtcggcgattttatctcg
ctgttcaacatcaagaccccatcgatggatcaggctatcggtctgctttctggtggaaac
cagcagaaggtggcgatcgcccgcggcctgatgacccgccccaaggttctcattcttgat
gagccgacgcgcggcgtcgacgttggcgccaaaaaagagatctatcagctgattaaccag
tttaaggcggaggggttgagcatcattctggtctcctccgaaatgcctgaggtgctggga
atgagcgatcgtatcctggttatgcatgacggacagctgagcggcgagttcccgattgca
caggcaacacaagaagtgctgatggccgcggccgttggcaagcaatacggcgttaagcag
gagtaa

DBGET integrated database retrieval system