KEGG   Edwardsiella piscicida C07-087: ETAC_16900Help
Entry
ETAC_16900        CDS       T02509                                 

Definition
(GenBank) D-ribose pyranase, putative
  KO
K06726  D-ribose pyranase [EC:5.4.99.62]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_16900
Enzymes [BR:etc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.62  D-ribose pyranase
     ETAC_16900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RbsD_FucU
Motif
Other DBs
NCBI-ProteinID: AGH75501
Position
complement(3816909..3817328)
Genome map
AA seq 139 aa AA seqDB search
MKKGTVLNSELSALISRLGHTDSVTVGDAGLPVPDGIQRIDLALTHGIPRFMQVIETITA
EMQVERAVLAQEMVEANPDIHRQLVAWLQQLAQTQGNAIHIDYVSHGQFKALSGESKAIV
RSGECSPYANVLLYAGVTF
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggcacggtattaaattctgaactttcagccctgatctcccgtctaggccat
acggacagcgtgacggttggtgatgccgggctgccggttcctgacggtatccagcgcatc
gatctggcgctgacccatggcatcccgcgttttatgcaggttattgagacgatcacggcg
gaaatgcaggttgagcgtgccgttttggcgcaggagatggttgaggctaatcctgatatt
caccggcagctggtggcgtggctgcagcagctggcgcagacgcagggcaatgcgattcat
atcgactatgtttcccacggtcagtttaaggcgctgagcggtgagagtaaggccatcgtc
cgcagcggagagtgttcaccctatgccaatgtactgctgtatgccggcgtgaccttttga

DBGET integrated database retrieval system