KEGG   Edwardsiella piscicida C07-087: ETAC_17005Help
Entry
ETAC_17005        CDS       T02509                                 

Definition
(GenBank) phosphate ABC transporter periplasmic substrate-binding protein PstS
  KO
K02040  phosphate transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
etc02020  Two-component system
Module
etc_M00222  Phosphate transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_17005
  09132 Signal transduction
   02020 Two-component system
    ETAC_17005
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_17005
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter [MD:M00222]
    ETAC_17005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PBP_like_2 SBP_bac_1 PBP_like SBP_bac_11
Motif
Other DBs
NCBI-ProteinID: AGH75522
Position
3840318..3841358
Genome map
AA seq 346 aa AA seqDB search
MKLMRTAVAGIVAATVSLSAMPAFAAESLTGAGATFPAPVYAKWADSYQKETGNKVNYQG
IGSSGGVKQIIANTVDFGASDAPLSEEKLAADGLFQFPTVIGGVVMAVNLPGITSGELTL
DGETLGDIYLGKIKKWNDAAIAKLNPGVKLPDQAIAVVRRADGSGTSFVFTSYLNKVNAQ
WKSDVGAGSTVNWPTGLGGKGNDGVAAFVQRLPGAIGYVEYAYAKQNKLAYTKLISSEGQ
AVSPTEVSFSNAAKGADWSASFAQDLTNQPGDNVWPITSTTFILVHKESSKPKQTAEVLK
FFDWAYSKGAKQANDLDYATLPASVVEHIRTAWKSSVKDSGGNALY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgatgcgtaccgctgtcgccgggattgtcgccgcgaccgtctccctgagcgcc
atgcctgcctttgcggcggagagcctgaccggtgccggtgccaccttccctgcgccggtt
tacgccaagtgggcagactcctatcagaaagagaccggtaataaagtaaactatcaaggc
attggctcctccggcggtgtgaagcagatcattgctaacaccgttgacttcggcgcctcc
gatgcgcccctgagcgaagaaaagctggcggcggacggcctatttcagtttccgacggtt
atcggcggcgtggtgatggccgttaacctgccgggtattacgtcgggcgagctgacgttg
gacggtgaaacgctgggtgatatctacctgggtaaaattaagaagtggaacgacgcggca
atcgctaagctgaacccgggggttaaactgccggatcaggctattgccgtggtgcgccgc
gccgatggttctggcacctcgtttgtctttaccagctacctgaacaaagtcaacgcacag
tggaagagtgacgtcggcgccggctccaccgttaactggccgacgggcctgggtggaaaa
ggtaacgatggcgttgccgcctttgtacagcgtctgccgggcgccatcggctacgtcgag
tatgcctatgccaagcagaataagctggcctacaccaagctgatctcctccgaggggcag
gcggtcagtccgacggaggtcagcttcagcaatgcggcaaaaggcgccgactggagcgca
tctttcgctcaggatctgacgaatcagcccggcgataacgtatggccgatcacctcgacc
accttcattctggttcataaagaatccagcaagcctaagcaaacggcagaggtgctgaag
ttcttcgattgggcctacagtaaaggggccaagcaggctaacgatctggactatgcaacc
ctgccggcgtcggtggtggagcatattcgtaccgcctggaaaagcagcgttaaggacagc
ggcggcaacgcgctgtactga

DBGET integrated database retrieval system