KEGG   Edwardsiella piscicida C07-087: ETAC_17015Help
Entry
ETAC_17015        CDS       T02509                                 

Gene name
pstA
Definition
(GenBank) phosphate transporter permease subunit PtsA
  KO
K02038  phosphate transport system permease protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00222  Phosphate transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_17015 (pstA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_17015 (pstA)
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter [MD:M00222]
    ETAC_17015 (pstA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AGH75524
Position
3842394..3843281
Genome map
AA seq 295 aa AA seqDB search
MATMDVQNPQKLAESRRRMQAWRRQKNRIALCLSMGTMAFGLFWLVWILLSTFTRGLDGM
SLALFTEMTPPPNTEGGGLANAIVGSGLLILWATVIGTPLGIMAGIYLAEYGRNGWFANV
TRFINDILLSAPSIVVGLFVYTIVVTKMQHFSGWAGVIALALLQVPIVIRTTENMLKLVP
DSLREAAYALGTPKWKMISAITLKASVSGIITGVLLAIARIAGETAPLLFTSLSNQFWST
DMMQPLANLPVTIFKFAMSPFAEWQQLAWAGVLLITLCVLLLNIVARVIFAKKKH
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgatggacgtacaaaatccgcagaagctggcggaatcccgtcgccgcatgcag
gcctggcgccgccagaaaaatcgtattgcgctgtgcctgtcgatgggcacgatggccttt
ggcctgttttggctggtgtggatcctgctatccacctttactcgtggcctggacggcatg
tcgctggcgctgtttaccgaaatgacgccgccgccgaataccgaaggcggcggtttggca
aacgccatcgttggctcggggctgctgatcctgtgggcgacggtgatcggcacgccgctg
gggatcatggcgggcatttatctggcggaatacggccgcaacggctggtttgccaacgtg
acccgttttattaacgatattctgttatctgcgccctctatcgtggtcgggctgttcgta
tacaccattgtggtgaccaagatgcagcacttttccggctgggccggggtgatcgcgctg
gcgctgctgcaggtgccgatcgttatccgcaccacggagaatatgttgaagctggtgccg
gacagcctgcgtgaggcggcctatgcgctggggacgcccaagtggaagatgatttcagcg
attaccctgaaagcgtccgtgtcggggattattaccggggtactgctggccatcgcccgt
atcgccggcgagacggcgcccctgctgtttacgtcgctctccaaccagttctggagcacc
gacatgatgcagccgctggccaacctgccggtcaccatcttcaagtttgccatgagcccg
tttgcggagtggcaacagttggcctgggccggcgtcctgctgatcacgctgtgcgttctg
ctgctgaatatcgtcgcccgcgtgatttttgccaagaaaaaacactaa

DBGET integrated database retrieval system