KEGG   Edwardsiella piscicida C07-087: ETAC_17020Help
Entry
ETAC_17020        CDS       T02509                                 

Gene name
pstB
Definition
(GenBank) phosphate transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00222  Phosphate transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_17020 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_17020 (pstB)
Enzymes [BR:etc01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     ETAC_17020 (pstB)
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter [MD:M00222]
    ETAC_17020 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_22 AAA_16 AAA_29 RsgA_GTPase Rad17 AAA_23 PRK AAA_30 PhoH Adeno_IVa2 ATPase_2 AAA_33 AAA_28 G-alpha AAA_25 RNA_helicase TniB AAA_5 AAA_24 AAA_7 AAA AAA_27
Motif
Other DBs
NCBI-ProteinID: AGH75525
Position
3843327..3844106
Genome map
AA seq 259 aa AA seqDB search
MSNVVTDPTNSKIQVRDLNFYYGKFHALKNISLDIEKNKVTAFIGPSGCGKSTLLRTFNK
MFQLYPEQRAEGEILLDGQNILTDSQDVALLRAKVGMVFQKPTPFPMSIYDNIAFGVRLF
EKLSRADMDERVQWALTKAALWSETKDKLHQSGYSLSGGQQQRLCIARGIAIRPEVLLLD
EPCSALDPISTSRIEELITELKQDYTVVIVTHNMQQAARCSDYTAFMYLGELIEFSDTDK
LFTAPAQRQTEDYITGRYG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgtagtgacagacccgaccaacagtaaaattcaggtgcgcgatctgaacttc
tattacggaaaattccacgcgctgaagaatatctcgctggatattgagaaaaacaaagtg
acggccttcatcggtccctccgggtgcggtaagtcgacgctgctgcgtacctttaacaag
atgttccagctttacccggagcagcgcgcagagggggagattttactggatggtcagaat
atcctgaccgacagccaggatgtcgcgctgctgcgcgccaaggtggggatggtgtttcag
aagccgacgccgtttcccatgtccatctacgacaatatcgccttcggcgtacgcctgttt
gaaaagctgtcgcgggctgatatggatgagcgggtgcagtgggcgctgaccaaggcggcg
ctgtggagtgagacgaaagataagctgcaccaaagcggctatagcctgtctggcggccag
cagcagcgtctgtgtatcgcccgcggcattgctatccgtccggaggtcttactgctggat
gagccctgctctgcgctggaccctatttcgaccagccgtatcgaggagctgatcaccgag
ctgaagcaggactacaccgtggtgatcgtgacccacaacatgcagcaggcggcgcgctgt
tctgattacactgcatttatgtatcttggtgaactaattgaatttagtgatacagataag
ctgtttaccgcccctgcgcagcggcagacggaagactatattaccggtcgctatggctga

DBGET integrated database retrieval system