KEGG   Edwardsiella tarda FL6-60: ETAF_0115Help
Entry
ETAF_0115         CDS       T02091                                 

Definition
(GenBank) 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase
  KO
K00549  5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd00270  Cysteine and methionine metabolism
etd00450  Selenocompound metabolism
etd01100  Metabolic pathways
etd01110  Biosynthesis of secondary metabolites
etd01230  Biosynthesis of amino acids
Module
etd_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:etd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ETAF_0115
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ETAF_0115
Enzymes [BR:etd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.14  5-methyltetrahydropteroyltriglutamate---homocysteine S-methyltransferase
     ETAF_0115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Meth_synt_2 Meth_synt_1
Motif
Other DBs
NCBI-ProteinID: ADM40238
UniProt: A0A0H3DM42
Position
125750..128026
Genome map
AA seq 758 aa AA seqDB search
MQVISHTLGFPRIGLQRELKKALEAYWSGSAPQSALLACGAELRARHWRQQHQAGIDLLP
VGDFAWYDHVLATSLMLGNVPARHRRADGVIDLDTLFGIARGRAPGGKPAAAAEMTKWFN
TNYHYIVPEFTRGQRFSFGWRQLLEEVDEALALGYRVKPVLLGPLTYLWLGKVKGAPFDR
LSLLEEVLAVYRQVLAALAERGVEWVQVDEPALVLTLPPAWRDAYQHAYQALRGPVKLLL
TTYFGDIGHHLPTICALPVQGLHVDLVQGAGDALALHRQLPADWVLSLGAIGGRNVWRAD
LADWQTRLQPLVGQRPVWLGSSCSLLHTPIDLSAETQLDEEVKSWFAFALQKCSELALLT
QALNDPASRREALLSYSAPLYLRRRSERVHNPAVTERLAALSDADTQRTSAYPQRARRQR
QRFALPLWPTTTIGSFPQTPAIRTLRLDFRRGQLTPQHYHRGIAEHIRQAIREQERLGLD
VLVHGEAERNDMVEYFGEQLAGFVFTCNGWVQSYGSRCVKPPVIVGDISRPAPLTVEWTT
FAQAQTSRPVKGMLTGPITMLCWSFAREDVPREVIARQLALALRDEVDDLQRAGIGIIQI
DEPALREGLPLRQDEWQAYLAWAVAAFRLTAAVAYDDTQIHTHMCYCEFNDIMAAIAALD
ADVITIETARSDMELLEAFSRFDYPNEVGPGVYDIHSPNVPTQAAMVSLLRRAAQHIPAE
RLWVNPDCGLKTRGWEETRRALSNMVAAARLLRAQTQA
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtaatcagtcataccctggggtttccacgcatagggctgcagcgtgagttgaaa
aaggcactggaggcctattggtcgggcagtgcgccccagagcgcgctactggcctgcggt
gccgagctgcgcgcccgccattggcggcagcagcatcaggcgggaatcgatctgctgccg
gtgggcgattttgcctggtatgaccatgtgttggcgaccagtctgatgctggggaatgtc
ccagcccgccaccggcgcgccgatggcgtgatcgatctggatacgctgtttgggattgcg
cgtggccgggcgcccggaggaaagcccgcggcggcggcggagatgacaaaatggtttaac
accaactatcactatatcgtgcctgagtttacccgggggcagcgcttttcctttggctgg
cgccagctgctagaggaggtggatgaggcgctggcgctgggataccgggtaaaaccggtg
ctgctggggccgctgacctacctgtggctcggcaaggtaaaaggggcgcctttcgatcgt
ctcagcctgctggaggaggtactggcggtataccgtcaggtgctggccgcgctggccgaa
cgcggggttgaatgggtgcaggtggatgagccggcgctggtgctgacgctgccgccggcg
tggcgcgatgcctatcagcatgcgtatcaggcgctgcgggggccggtgaagctgctgctg
accacctactttggcgatatcggccaccacctgccgacgatctgcgctctgccggtgcag
gggctacacgtcgatctggttcagggcgcgggcgatgcgctggcgctccaccgtcagctg
cccgccgactgggtgctatcgctgggcgcgatcggcggccgtaacgtctggcgcgccgat
ctggccgactggcagacgcgtctgcagccgctggtcggtcagcggcccgtctggctgggc
agttcctgctccctgctgcatacgcctatcgatctgagcgccgaaacccagctggatgag
gaggtgaaaagctggtttgcctttgccctgcagaagtgcagtgagctggcgctgctgacc
caggccctgaacgatccggcgtcgcggcgggaggcgctgctgagctacagtgcgccgcta
tacctgcgacgtcgctcggaacgggttcataacccggcggtgaccgagcgcctggccgca
ctaagcgacgcggatacgcagcgtaccagcgcatacccccagcgcgctcggcgtcagcgc
cagcgttttgctctgccgctctggccgacgacgaccatcggttcattcccgcagacgccg
gctatccgcaccctgcgcctcgactttcgccgcggtcagctgaccccgcagcactaccat
cgggggatcgctgaacatatccgtcaggcgattcgcgagcaggagcgactggggctggac
gtactggtgcacggcgaggccgaacgtaatgatatggtggagtatttcggtgagcagctg
gcggggtttgtgtttacctgtaacggttgggtacagagctatggctcacgctgcgtgaag
ccgccggtgatcgttggggatatcagtcggcccgcgccgctaaccgtcgaatggaccacc
tttgctcaggctcagacctcccggccggtgaagggcatgctgaccggtccgataacgatg
ctgtgctggtcgtttgctcgtgaagatgtgccgcgagaggtgatcgctcgtcagctggcg
ctggcgctgcgcgacgaggtagacgacctgcagcgcgcggggatcggcatcattcaaatc
gacgagcccgcgctgcgcgagggcctgccgctgcgtcaggatgagtggcaggcgtacctg
gcgtgggccgtggcggcgtttcgcctaacggcggcggtggcgtacgatgatacccagatc
catacccatatgtgctactgcgagttcaatgacatcatggcggcgattgcggcgctggat
gccgacgtgatcaccattgaaacggcgcgatcggatatggagctgctggaggccttttct
cgcttcgactatcccaatgaggtcggccccggggtgtacgatatccactcaccgaacgtg
ccgacgcaggcggcgatggtctcgctgctgcgtcgggcggcacagcatattcccgccgag
aggctgtgggtgaatccggactgtggtttaaagacgcgcggctgggaggagacccgtcgt
gcgctgagtaacatggtggcggcggcgcgtttgctgcgcgcgcagacgcaggcgtaa

KEGG   Edwardsiella tarda FL6-60: ETAF_0172Help
Entry
ETAF_0172         CDS       T02091                                 

Definition
(GenBank) 5-methyltetrahydrofolate--homocysteine methyltransferase
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd00270  Cysteine and methionine metabolism
etd00450  Selenocompound metabolism
etd00670  One carbon pool by folate
etd01100  Metabolic pathways
etd01110  Biosynthesis of secondary metabolites
etd01230  Biosynthesis of amino acids
Module
etd_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:etd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ETAF_0172
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ETAF_0172
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ETAF_0172
Enzymes [BR:etd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     ETAF_0172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Met_synt_B12 S-methyl_trans Pterin_bind B12-binding_2 B12-binding
Motif
Other DBs
NCBI-ProteinID: ADM40295
UniProt: A0A0H3DP24
Position
204731..208414
Genome map
AA seq 1227 aa AA seqDB search
MNTTLERLRRRLEKRILVLDGGMGTMIQRYGLSEQDFRAERFADWPCDLKGNNDLLALTR
PDIISAIHYAYLEAGADILETNTFNATRIAMADYRMEALAPEINYRAACLARACADEWTA
RTPHQPRFVAGVLGPTNRTASISPEVNDPACRNITFDQLVAAYRESARALIEGGVDLLMI
ETVFDTLNAKAAVYALECEFAALGVTLPVMISGTITDASGRTLSGQTTEAFYNALRHARP
LSFGLNCALGPEDLRQYVAELSRVAECHVSAHPNAGLPNAFGEYDLSPQAMAQQIAEWAR
AGYLNIVGGCCGTTPEHIAAISRAVQGITPRALPTLPVACRLSGLEPLTIDETSLFVNVG
ERTNVTGSAKFKRLIKENKYDEALDVARQQVASGAQIIDINMDEGMLDAEAAMVRFLNLI
AGEPDIARVPLMIDSSRWSVIEAGLKCIQGKGIVNSLSLKEGEANFLEHARQVRRFGAAL
VVMAFDEQGQADTRERKVAICRRAYQLLTERIGFPPEDIIFDPNIFAVATGIEEHSNYAV
DFIASCAEIKAQLPHALISGGVSNVSFSFRGNEAVREAIHAVFLYHAIRHGMDMGIVNAG
QLAIYDDLPDDLRTAAEAVILNQSPDATDRLLALAERYRDTQGSAQAEAQQAEWRSWPVA
QRLEYALVKGIGEFIAQDTEAARLEADRPIAVIEGPLMAGMNRVGDLFGDGKMFLPQVVK
SARVMKQAVAYLSPFIEASKQRGSSAGKVLLATVKGDVHDIGKNIVGVVLQCNNYEIIDL
GVMVPAERILRVAREERVDIIGLSGLITPSLDEMVNVASEMERQGFTLPLLIGGATTSKA
HTAVKIAPAYGGPTVYVQNASRTVGVVAALLSEAQRGPFIDRTRREYEAARAQHGRQTPR
TPPVTLAQARANGVVTDWSACPPPVPLRLGVQTVQPGIARLRDYIDWTPFFLTWSLAGKY
PRILQDEVVGEEARRLLADANGLLDRLEASGSLTPRGVFGLFAANRRGDDVLIYRDESRR
EVLAVSHHLRQQSDKRVGPNYCLADFVAAADEGIADYIGAFAVTGGLEEEALAQAFDAQH
DDYHKIMVKALADRLAEAFAEYLHQQVRKVHWGYAADEALDNEQLIRENYRGIRPAPGYP
ACPEHSEKATLWRLLDVERHTGMRLTESYAMWPGASVSGWYFSHPHSKYFAVARVQRDQV
ADYAARKGMTLAEAERWLAPNLGYEVA
NT seq 3684 nt NT seq  +upstreamnt  +downstreamnt
gtgaatacgacgcttgaacggttgcgccgccggctggagaaacggattttggtgttggat
ggcggcatgggaaccatgatccagcgttacgggctgagcgaacaggatttccgcgccgaa
cgctttgccgattggccctgcgatctgaagggaaacaacgatctgctggcgctgacccgc
cccgatatcatcagcgcgattcattatgcctacctggaggcgggcgccgacattctggaa
accaacacctttaacgcaacgcgcatcgccatggcggactaccgcatggaggcgctggcg
ccggagataaattatcgggccgcctgccttgcgcgggcctgtgccgacgagtggacggcg
cgcacgccgcaccagccgcgcttcgtggcgggcgtgctggggccgaccaaccgtacggcg
tcgatctcgccggaggtcaacgatcccgcctgtcgcaatattaccttcgatcagctggtg
gcggcctatcgcgagtcggcgcgggcgctgattgagggcggcgtcgatctgctgatgatc
gaaaccgtctttgatactctgaatgccaaggcggcggtttatgcgctggagtgcgagttt
gccgcgctgggcgtcacgctgccggtgatgatctccggcaccattaccgatgcctccggg
cgtaccctgtcggggcagacgaccgaggcgttttataacgccctgcgccacgcccgtccg
ctctctttcggtctgaactgcgctctgggcccggaggatctgcgccagtacgtggcggag
ctgtcccgggtcgccgagtgccacgtcagcgcccaccccaacgccgggctgcccaatgcc
tttggcgagtatgatctctcgccgcaggcgatggcgcagcagattgccgaatgggcccgc
gcgggctacctgaatatcgtcggcggctgctgcggtaccacgccggagcacattgccgcc
atcagccgggcggtgcagggcatcacaccgcgcgcccttcccacgctgccggtggcctgc
cgtctgtccggtctggagccgctgacgatcgatgaaacgagtctgttcgtcaacgtgggc
gaacgcaccaacgtgaccggctctgctaaatttaagcgactgattaaagagaataaatat
gatgaggcgctggacgtggcacgtcagcaggtggcgagcggcgcgcagatcatcgatatc
aatatggatgagggcatgctggatgccgaggcggcgatggtccgcttcctcaacctgatt
gccggcgagccggatatcgcccgggtgcccctgatgatcgactcctcccgctggtcggtg
atcgaggcggggctgaagtgcatccaggggaaaggcatcgtcaactcgctctctcttaaa
gagggagaggcgaactttctggagcacgcccgtcaggttcgccgctttggcgccgcgctg
gtggtgatggccttcgatgagcaggggcaggcggatacccgagagcgtaaggtggccatc
tgccgtcgcgcctatcagctgctgaccgagcgcatcggtttcccgcctgaagacatcatc
tttgaccccaatatttttgccgtggccaccggcattgaggagcacagtaactatgccgtc
gattttatcgcatcctgcgcggagattaaggcgcaattaccccacgccctgatctccggc
ggggtgtcgaacgtctctttttccttccgcggtaacgaggcggtgcgagaggcgatccac
gcggtctttctgtatcacgcgattcgccacggcatggacatggggatcgttaacgccgga
cagctggctatctatgacgacctgccggacgatctgcgtacggcggccgaggcggtgatc
ctgaaccagagccccgacgccaccgatcgcctgctggcgctggcggagcgctaccgcgac
acgcagggcagcgcgcaggcggaggcgcagcaggccgagtggcgcagctggccggtggcc
cagcgcctggagtatgccttggtcaagggcatcggcgagttcattgcgcaggataccgag
gcggcgcgtctggaggccgacaggccgattgcggtgatcgaagggccgctgatggcgggg
atgaaccgggtcggcgatctgtttggcgacggtaagatgtttctgccgcaggtggtgaag
tcggcgcgagtgatgaagcaggcggtggcctatctgtcgccgtttatcgaggccagcaag
cagcgcggcagcagcgccggtaaggtgctgctggcgacggtgaagggcgacgtgcacgat
atcggcaagaatatcgtcggcgtagtgctgcagtgcaataactatgaaattatcgatctg
ggggtgatggtgcccgccgagcgaatcctgcgggtggcgcgcgaggagcgggtcgatatc
atcgggctgtcggggctgatcaccccctcgctggatgaaatggtcaacgtggccagcgaa
atggagcggcaggggttcacgctgccgctgctgatcggtggggcgacgacctccaaggcg
catacggcggtgaagattgcgcccgcctacggcgggccgacggtctatgtgcagaacgcg
tcgcgcaccgtcggcgtggtggccgccctcctgtcggaggcgcagcggggtccgtttatc
gaccggacgcgccgggagtatgaggcggctcgtgcccagcatggtcgccagacgccgcgc
acgccgccggtgacgctggcgcaggcgcgcgccaatggcgtcgtcaccgactggtcagcc
tgtccgccgccggtgccgctgcgcttaggggtacagacggtgcagccggggattgcgcgt
ctgcgcgactatatcgactggacgccgtttttcctcacctggtcattggccgggaaatac
ccgcggatcctgcaggatgaggtggtcggcgaggaggcgcggcgcctgctcgcggatgcc
aatgggttactggataggctggaggcgtccggtagtctgacgccgcgcggggtgttcggc
ctgttcgcggcgaaccggcggggggacgatgtgctgatttaccgcgacgagagccgccgc
gaggtgctggccgtcagccaccatctgcgccagcagagcgataaacgcgtggggcccaac
tactgcctggctgactttgtcgccgccgcggatgaggggatcgctgactatatcggcgcc
tttgccgtgaccggcgggctggaggaggaggcgctggcgcaggcctttgatgcgcagcac
gatgactaccataaaatcatggtgaaggcgttagcggatcgtctggcggaggcctttgcc
gaatacctgcatcagcaggtgcgcaaagtgcactggggctatgccgccgatgaggcgctg
gacaacgagcagttgatccgcgaaaactatcgcggcattcgcccggcgccgggctatccg
gcctgtccggagcacagtgaaaaggccacgctgtggcgtcttttagacgtcgaacgccac
accggcatgcggctgacggagtcttacgcgatgtggccgggcgcctcggtgtccggctgg
tacttcagccaccctcacagcaagtactttgccgtcgcgcgcgtgcagcgcgatcaggtg
gcggactatgccgcgcgtaaagggatgacgctggcggaggccgagcgttggctagcgccc
aatctgggctatgaggtggcgtaa

DBGET integrated database retrieval system