KEGG   Edwardsiella tarda FL6-60: ETAF_0127Help
Entry
ETAF_0127         CDS       T02091                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd00860  Porphyrin and chlorophyll metabolism
etd01100  Metabolic pathways
etd01110  Biosynthesis of secondary metabolites
etd01120  Microbial metabolism in diverse environments
Module
etd_M00121  Heme biosynthesis, glutamate => heme
etd_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ETAF_0127
Enzymes [BR:etd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ETAF_0127
Exosome [BR:etd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ETAF_0127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ADM40250
UniProt: A0A0H3DP07
Position
138961..139983
Genome map
AA seq 340 aa AA seqDB search
MSYAFPGAFPGRRLRRLRRHDFSRRLCAENVLTVDDLIYPVFVMEGNNHQEAVSSMPGVQ
RMTIDVLVREAEAVAKLGVPVLSLFPVVGTDKKSLYAEEAYSSDGLVQRAVRALKDAVPE
LGILTDVALDPYTTHGQDGVIDEDGYVVNDITKEILVRQALSHAEAGADIVAPSDMMDGR
IGAIRSMLESQKLVNTQIMAYSAKYASCYYGPFRDALGSSGNLKGGNKKTYQMDPANGDE
ALQEVAQDLQEGADMVMVKPGMPYLDVLRRVKDTFGVPTFAYQVSGEYAMHMAAIQNGWL
QEKPAIMESLICFKRAGADGVLTYFAKRVAQWLHDAEMTR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgagctatgcatttccaggcgcctttccggggcgtcgcctgcgccgtctgcgccggcat
gattttagtcgccgtctgtgtgccgaaaacgtgctgacggttgacgatctgatctatccg
gtgtttgtgatggaggggaacaaccatcaggaggcggtctcctccatgccgggggttcag
cgcatgaccatcgatgtcctggttcgtgaggccgaggccgtcgctaagctgggcgtgccg
gtgctgtcgctgttcccggtggtcggtacggataaaaaatcgctgtatgccgaagaggcg
tacagcagcgatggtctggtgcagcgcgcggtgcgggctctgaaggatgcggtgcctgag
cttggcatcttaaccgacgtcgcgctggatccgtatacgacgcacggccaggatggcgtg
atcgatgaggacggctacgtcgtcaacgatatcacgaaagagatcctggtgcgtcaggcc
ttatcccatgccgaggccggtgccgatatcgtggcgccgagcgatatgatggatggccgc
attggcgctatccgcagcatgctggagagccaaaagctggtcaatacccagatcatggct
tactccgcgaagtatgcctcttgctactacggtccgttccgcgatgcgctgggctcctct
gggaacctgaagggcggcaacaagaaaacctatcagatggacccggctaacggggatgag
gcgctgcaggaggtggctcaggatctgcaggagggggccgatatggtgatggttaaacca
ggtatgccgtatctggacgtattacgccgagtgaaagatacctttggcgtgccgaccttc
gcctatcaggtctccggtgagtatgccatgcatatggctgcgatccagaacggttggctg
caggagaagccggcgatcatggagtccctgatttgcttcaagcgggcgggcgccgatggc
gtgctgacctattttgccaagcgtgtggcacagtggctgcatgatgcagagatgacgcgc
tga

DBGET integrated database retrieval system