KEGG   Edwardsiella tarda FL6-60: ETAF_0161Help
Entry
ETAF_0161         CDS       T02091                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd00010  Glycolysis / Gluconeogenesis
etd00620  Pyruvate metabolism
etd00640  Propanoate metabolism
etd00680  Methane metabolism
etd01100  Metabolic pathways
etd01110  Biosynthesis of secondary metabolites
etd01120  Microbial metabolism in diverse environments
etd01130  Biosynthesis of antibiotics
etd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAF_0161
   00620 Pyruvate metabolism
    ETAF_0161
   00640 Propanoate metabolism
    ETAF_0161
  Energy metabolism
   00680 Methane metabolism
    ETAF_0161
Enzymes [BR:etd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ETAF_0161
Lipid biosynthesis proteins [BR:etd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ETAF_0161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADM40284
UniProt: A0A0H3DP14
Position
complement(189722..191677)
Genome map
AA seq 651 aa AA seqDB search
MSQIHTYPVPADIARHAFINAEMYREMYLASVEDPEAFWAEQGQIISWITPYSRVKNTSF
DPGHINIRWFEDGTLNLAANCLDRHLAERGEQTAIIWEGDDPQESRRVTYRQLHGEVCRF
ANVLKSLQVEKGDVVAIYMPMVVEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSGA
KLVITADEGVRAGRTIPLKRNVDEALQHPQVNSVHHVVVFRRTGGAGEWDSGRDRWWHEL
MAQADEHCPAVEMNAEDPLFILYTSGSTGKPKGVLHSTGGYLVYAATTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLANGAITLMFEGVPNYPGINRLSQIVDKHQVNILYTAPTA
IRALMAEGQRAVADTQRTSLRIMGSVGEPINPEAWEWYYHTIGNGHCPIMDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNSGEILEGASEGNLVILDSWPGQARTLFGA
HERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGIPHSIKGQAIYAYITLNVGEEPSPALYAEVRDWVRKEIGPIATPDILHWTD
ALPKTRSGKIMRRILRKIASGDISNLGDTSTLADPGVVEKLLEEKQAMQPR
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgagccagatccatacctaccctgttccggcggatattgcccggcatgcctttatcaat
gcggaaatgtatcgtgaaatgtatctggcctctgtcgaggaccccgaggcgttctgggcg
gagcagggacagatcatcagctggataaccccctatagccgggttaagaatacctccttc
gatccaggccatatcaatatccgttggtttgaggatggcaccctcaacctggcggccaac
tgcctggatcgccatctggccgaacgcggcgaacagacggccatcatctgggagggcgac
gatccgcaggagagccgcagagtaacctatcgtcagctgcacggtgaggtgtgccgcttc
gccaacgtgctgaaatcactgcaggtagaaaagggcgacgtcgtcgcgatctatatgccc
atggtggtcgaggcggcggttgccatgctggcctgcgcgcgaattggcgccgtacactcg
gtgatcttcggtggcttctccccagaggcggttgccgggcgcattatcgactccggagcc
aaactggtgatcacggcagatgaaggggttcgcgccgggcgaaccattccactcaagcgc
aacgtcgacgaagcgctgcagcatcctcaggtcaacagcgtgcaccatgtcgtggtattc
cgccgtaccggcggcgccggcgaatgggacagcggccgcgatcgttggtggcatgagctg
atggcccaggccgatgaacactgccccgcggtggagatgaacgccgaagatccgctgttt
attctgtatacctccggatcgaccggtaaaccgaagggcgtactgcacagtaccggcggc
tatctggtatacgcggcgaccacctttaagtatgtgtttgactaccatcccggcgatatt
tactggtgtacggcggacgtcggctgggtcaccggccacagctatctgctgtatggcccc
ttggccaacggcgccataacgctgatgtttgagggggtccccaactatcccggcattaat
cgcctcagccagatcgtagacaagcatcaggtcaatattctgtataccgcgccgacggcg
atccgcgcgctgatggcagagggacagcgcgccgtcgccgacacccagcggacctcgctg
cgcataatgggatcggtcggtgagccgatcaaccccgaggcctgggagtggtattaccat
accatcggcaacggccactgcccgatcatggatacctggtggcagaccgaaaccggcggc
tttatgatcaccccgctgcccggagccaccgagcttaaagccggatcggccacccgcccc
ttttttggcgtacagcccgccctggtcgataacagcggggagatcctggagggcgccagt
gaaggcaatctggtgatcctggactcttggcccgggcaggcacgtacgctgtttggcgcc
catgaacgctttgaacagacctacttctccacctttaaggggatgtatttcagcggcgac
ggtgcccgacgtgacgaagacggctattactggataaccggtcgcgtcgacgatgtactc
aacgtctcaggacaccgcctgggcacagcggagatcgaatctgcgctggtcgcgcacccg
aagatcgccgaggcggccgtcgtcgggatcccccacagcattaaagggcaggcaatctat
gcctatatcacgctgaacgtaggcgaggaaccatcgcccgcgctgtacgccgaggtccga
gactgggtacgtaaagagatcggtcccatcgccacaccggatatcctgcactggaccgat
gcgctgcccaaaactcgctccggcaagatcatgcgccgcatcctgcgcaaaattgccagc
ggcgatatcagcaatctgggcgatacctctacgctggccgatcctggcgtcgtagaaaaa
ctgctggaggagaaacaggctatgcagccgcgttaa

DBGET integrated database retrieval system