KEGG   Edwardsiella tarda FL6-60: ETAF_0273Help
Entry
ETAF_0273         CDS       T02091                                 

Definition
(GenBank) Heat shock protein 60 family chaperone GroEL
  KO
K04077  chaperonin GroEL
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:etd00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    ETAF_0273
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:etd03019]
    ETAF_0273
   03110 Chaperones and folding catalysts [BR:etd03110]
    ETAF_0273
   03029 Mitochondrial biogenesis [BR:etd03029]
    ETAF_0273
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etd04147]
    ETAF_0273
Messenger RNA biogenesis [BR:etd03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     ETAF_0273
Chaperones and folding catalysts [BR:etd03110]
 Heat shock proteins
  HSP60 / Chaperonin
   ETAF_0273
Mitochondrial biogenesis [BR:etd03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    ETAF_0273
Exosome [BR:etd04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ETAF_0273
  Exosomal proteins of other body fluids (saliva and urine)
   ETAF_0273
  Exosomal proteins of breast cancer cells
   ETAF_0273
  Exosomal proteins of colorectal cancer cells
   ETAF_0273
  Exosomal proteins of bladder cancer cells
   ETAF_0273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn60_TCP1
Motif
Other DBs
NCBI-ProteinID: ADM40397
UniProt: A0A0H3DQU0
Position
322711..324354
Genome map
AA seq 547 aa AA seqDB search
MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGSPTITKDGVSVAREI
ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI
DKAVTAAVEELKALSVPCSDSKAIAQVGTISANADDTVGQLIAEAMEKVGKEGVITVEEG
TGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAV
AKAGKPLLIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIATLTAGTV
ISEEIGMELEKATLEDLGQAKRVVINKDTTIIIDGVGEESAIQGRVTQIRQQIEEATSDY
DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVAGGGVALV
RVAAKLVDLKGINEEQNVGIKVALRAMEAPLRQIVANAGEEPSVVTNNVKAGEGNYGYNA
ATEEYGDMIDMGILDPTKVTRSALQYASSVAGLMITTECMVTDLPKEEKADLGAAGMGGM
GGMGGMM
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggcagctaaagacgtaaaatttggtaatgacgcccgcgtaaaaatgctgcgcggcgtg
aacgttctggcagacgcagtgaaagtgaccctgggtccgaaaggccgtaatgtggtcctg
gataaatccttcgggtctccgaccatcaccaaagacggcgtgtccgttgcgcgtgaaatc
gaactggaagacaagttcgagaacatgggcgcgcagatggtgaaagaagtcgcctccaag
gcgaatgacgccgccggtgacggcaccaccaccgcaaccgtactggcacaggctatcgtt
aacgaaggtctgaaagccgtggctgcgggtatgaacccgatggatctgaagcgcggcatc
gacaaagccgtgaccgccgccgttgaagagctgaaggcgctgtctgtaccgtgctctgac
tctaaagccattgcgcaggtagggaccatctccgccaacgccgacgacaccgtgggccag
ctgatcgctgaagccatggaaaaagtgggtaaagaaggcgttatcaccgttgaagaaggc
accggtctgcaggacgagctggacgtggttgaaggtatgcagttcgatcgcggctacctg
tctccgtacttcatcaacaagccggaaaccggcgccgttgagctggaaagcccgttcatt
ctgctggctgacaagaagatctccaacatccgcgaaatgctgccggtgctggaagccgtt
gctaaagccggtaagccgctgctgatcatcgccgaagacgttgaaggcgaagcgctggcg
accctggtggtcaacaacatgcgcggtatcgtgaaagtggctgcggtgaaagcgccgggc
ttcggcgatcgtcgtaaggcgatgctgcaggatatcgctaccctgaccgccggtaccgtt
atctctgaagagatcggtatggagttggaaaaagcgacgctggaagatctgggccaggct
aaacgcgtggtcatcaacaaagacaccaccattatcatcgatggcgtgggcgaagagtct
gccattcagggtcgtgttactcagatccgtcagcagatcgaagaagcgacctctgactac
gatcgtgaaaaactgcaggagcgcgtggctaaactggcgggcggcgtagccgttatcaag
gttggcgcggcaactgaagttgaaatgaaagagaagaaagcacgcgtagaagacgccctg
cacgcaacccgtgctgcggtggaagaaggcgtggtggccggcggcggcgtggcgctggtt
cgcgtagcggccaagctggttgatctgaaaggcatcaacgaagagcagaacgtcggtatc
aaggttgcgctgcgcgcgatggaagcgccgctgcgtcagatcgtggccaacgccggtgaa
gagccgtcagtggtcaccaacaacgtgaaggccggcgaaggtaactacggctataacgcg
gcgaccgaagagtacggcgacatgatcgatatgggtatcctggatccgaccaaggtaacc
cgctctgcgctgcagtacgcttcctctgttgccggtctgatgatcaccaccgagtgcatg
gtgaccgatctgccgaaggaagagaaagctgacctgggtgctgccggtatgggtggcatg
ggcggtatgggcggcatgatgtaa

DBGET integrated database retrieval system