KEGG   Edwardsiella tarda FL6-60: ETAF_0535
Entry
ETAF_0535         CDS       T02091                                 

Definition
(GenBank) Xanthine dehydrogenase iron-sulfur subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd00230  Purine metabolism
etd01100  Metabolic pathways
etd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:etd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAF_0535
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: ADM40659
UniProt: A0A0H3DN82
Position
complement(623914..624399)
AA seq 161 aa
MNVKEWGEISCQINGKNYQFCVSPAMSLLEMLREHGLTSVKQGCCVGECGACSVLIDGVA
TDSCLYLALWADGKQIVTAEGLGRTDSLSPIQQAYVDAGAVQCGFCTPGLVVATHALLAK
PRSRPLTHEEIRRGLSGNLCRCTGYQAIVRAVDLCQREEEQ
NT seq 486 nt   +upstreamnt  +downstreamnt
atgaatgtcaaagagtggggtgaaatcagctgccagatcaatgggaaaaactatcagttt
tgcgtatcgccggcgatgtcactgctggaaatgctgcgcgagcacgggctaaccagcgtg
aagcagggctgctgcgtcggcgaatgcggcgcctgcagcgtattgatcgatggcgtggca
accgacagctgcctgtatctggcgctgtgggccgacggtaagcagatcgtcacggccgaa
gggctggggcgaaccgacagcctttcaccgatccagcaggcctatgtcgacgccggtgcc
gtgcagtgcggcttctgtaccccgggactggtggtcgcgacccatgccctgctggcgaaa
ccgcgcagccgcccgctgacgcacgaagagatccgccgcggcctctccggtaacctgtgc
cgctgcaccggctatcaggccatcgtacgcgccgtcgatctctgccagcgcgaagaagag
cagtaa

DBGET integrated database retrieval system