KEGG   Edwardsiella tarda FL6-60: ETAF_0537
Entry
ETAF_0537         CDS       T02091                                 

Definition
(GenBank) Xanthine dehydrogenase, molybdenum binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd00230  Purine metabolism
etd01100  Metabolic pathways
etd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:etd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAF_0537
Enzymes [BR:etd01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     ETAF_0537
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ADM40661
UniProt: A0A0H3DQC0
Position
complement(625281..627572)
AA seq 763 aa
MSLGSPLRRVDAEAKVTGQARYTDDMMMPGMLHACYVRSRIAHGNVTAIDTREAESMPGV
EAVFTFHDVPSAPFPTAGHAWSLEPGKRDIADRHLLTGHVRHFGDGVAIVVARDLLSAER
AAERVQVSYEALPVITRPLAALADNAPAIHPGGNLLRHSEIDAGEPDARMAAADLQLEGH
YETPVVQHCHMEGVTCYAYMEQPDHIVIVSSTQIPQIVRRTVAQALGLPWSHVRVIKPYV
GGGFGNKQDVLEEPMAAFLTQRLGGKPVKVSLSREECFVATRTRHAFSIDARLGMRRDGQ
LEGYRLTVLSNTGAYASHGHSIAAAGANKISYLYPRSAFGYCADTVYTNLPAAGAMRGYG
APQVDFALECLMDDAAARLDLDPLEVRLRNVARQGDRNPVNGKTIYSAGLTECLEKGRRL
FEWDQRRAECLAQPADAPVRRGVGVACFSYGSNTYPVGVEIAGARLLLNQDGTVNLQIGA
TEIGQGSDTVFAQMASETLGIPFKQIRVISTQDTDITAFDPGAFASRQSYVAAPAIRRAA
EIMRQKILAHAALISHQPEWGLTLCDGNVVMAMQPDQVLMSVADVAMQAYYHQEIGAQIL
AEVSHKTTTNPPAFGCTFVDLSIDIALCQVTINRILNLHDSGRILNPQLAEGQVHGGMGM
GIGWALFEEMIIDEKSGVVRNPNLLDYKFPTCVDLPDLECAFVETVEPQSAYGHKALGEP
PIISPGPAIRNAIRMATGVAINALPITPKTLYREFVQAGLIRE
NT seq 2292 nt   +upstreamnt  +downstreamnt
atgtctttaggatcgccgctgcggcgggttgatgccgaagccaaggtcaccggacaggca
cgttataccgatgatatgatgatgcccggcatgctccatgcctgctacgtgcgcagccgt
atcgcccacggtaacgtcaccgccatcgatacccgggaagcggagtccatgcccggcgta
gaagccgtcttcacctttcacgatgtcccctcagcccccttccctaccgccggccatgcc
tggtcactggagccgggcaaacgggatatcgccgatcgccatctgctgaccggccacgta
cgccactttggcgatggcgtcgccatcgtcgtcgcccgcgatctgctcagcgccgagcgc
gccgcggagcgggtacaggtcagctatgaggcgttgccggtgatcacccgaccactggcg
gccctggccgataatgcgccggccattcaccccggcggcaatttactgcgtcacagcgag
atcgacgccggagagcccgatgctcgcatggccgccgccgatctgcagctggagggacac
tacgagacgccggtggtgcagcactgccacatggagggcgtgacctgctatgcctatatg
gagcagcccgatcacatcgtcattgtctccagcacccaaattccccagattgtccgccgc
accgtcgcccaggccctcggtctcccctggtcgcacgtccgagtgatcaagccctacgtc
ggcggcggattcggcaataagcaggatgtgctagaagagcccatggccgcctttttaacc
cagcgcctcggcggtaaaccggtcaaggtcagcctgagccgcgaggagtgcttcgtcgcc
acccgcactcgccatgccttcagcatcgatgcccggctgggcatgcgtcgggatggacaa
ctggagggctaccggcttacggtgctgtccaacaccggcgcctatgcctctcacggccac
tcgatcgccgccgccggcgccaataaaatcagctatctctatccccgcagcgcctttggc
tactgcgccgatacggtatataccaacctgcccgccgccggtgcgatgcgcggctacggc
gcgccgcaggtcgactttgccctggaatgcctgatggacgacgccgccgcccgtctcgat
ctcgaccccctcgaggttcgtctgcgcaacgtcgcgcgtcagggggaccgcaacccggtt
aacggcaagaccatctacagcgccgggctcaccgagtgcctggaaaaaggccgccgcctg
tttgagtgggatcagcgccgcgccgaatgtctggcccagccggccgatgcgccggtgcgg
cgcggcgtcggcgtcgcctgtttcagctatggctccaatacctatccggttggggtggag
atcgccggcgcccgcctgctgctcaatcaggacgggacggtaaacctgcagattggcgcc
accgaaatcggccagggatccgacaccgtctttgcccagatggcatcggagacgctgggg
atcccctttaaacagatccgggtgatctcaactcaggataccgatatcaccgccttcgat
cccggcgcctttgcctcacggcaaagctacgtcgccgccccggcgatccgccgagcggcg
gagatcatgcgccagaagatcctggcgcacgcggcgctgataagccaccagccggagtgg
ggattgaccctgtgcgacggtaacgtcgtgatggcgatgcagccggatcaggtgctgatg
agcgtcgccgatgtcgccatgcaggcttactaccatcaggagatcggcgcgcagatcctg
gccgaggtctcccataaaaccaccaccaatcccccggccttcggctgcacctttgtcgat
ctcagcatcgatatcgcgctgtgccaagtcaccattaaccgcatcctgaatctgcatgac
tccgggcggatcctcaacccgcagctggcggaggggcaggtgcacggcggcatgggaatg
gggatcggctgggcgctgttcgaagagatgatcatcgatgagaagagcggcgtggtacgc
aacccgaatctgctcgactacaaattccccacctgtgtcgatctgccggatctggagtgc
gcctttgtcgagaccgtggagccgcagtcggcctatggccacaaggcgctgggtgagccg
ccgatcatttcgcctggaccggcgatccgcaacgccattcgcatggcaacgggggtcgcg
atcaatgcgctgccgatcacccccaaaacgctgtatcgcgaatttgtgcaggccggactg
atcagggagtaa

DBGET integrated database retrieval system