KEGG   Edwardsiella tarda FL6-60: ETAF_0650Help
Entry
ETAF_0650         CDS       T02091                                 

Definition
(GenBank) Exodeoxyribonuclease V gamma chain
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:etd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    ETAF_0650
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:etd03400]
    ETAF_0650
Enzymes [BR:etd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ETAF_0650
DNA repair and recombination proteins [BR:etd03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     ETAF_0650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C SUKH-4
Motif
Other DBs
NCBI-ProteinID: ADM40774
UniProt: A0A0H3DNH0
Position
758092..761478
Genome map
AA seq 1128 aa AA seqDB search
MFTVYHSNQLDVLTQLMAALMQGQPLETPFEREVILVQSPGMSQWLQMELARSFGIAANI
DFPLPATFIWDLFTRVLPDIPQRSAFSKDAMTWKLMWLLPQFLDRPAFAPLAHYLSDDTD
RRKHFQLAARIADLYDQYLVYRPEWLQRWEQGGLIEGLDSAQQWQAPLWVALRDYTEQLG
QPQWHRANLYQRFIQALKVSDRAPPGLPRRVFICGISALPPVYLEALRALGEHIDVHLMF
TNPCRYYWGDIQDYAFLARLQSRRRRDYLLAQRSLGESQSALFRTPEQAAALFSEEGEQA
LSNPLLASWGKLGRDHMYLLAQHGPQEVSAFVDLAQETLLQRIQRDMLELEDHACIAAAG
QTLQDSRQKRRLASDDRSISVHVCHSPQREVEVLHDSLLDMFAADATLSARDVIVMVADI
DSYAPFIQAVFGNAPAGRYLPFAISDRSARQLHPVVQALLALLDLPHSRFNAEQVLALLE
VPALAARFDIDDDGIRLLRHWVEESGIRWGLDDDAVRDLALPATGQHTWQFGLTRMLLGY
AMDSRSGEWQGVLPYDESSGTIAELAGQLAQFLAALREWRQRLGQMQTLAQWQPLCRALL
EDFFVTDADSEAVCALIEQQWLKLIEEGLASAYPETLPITVLRDELTARLDNQRISQRFL
AGPINFCTLMPMRSIPFKVVCLLGMNDGVYPRTLAPLGFDLMAGKAQRGDRSRRDDDRYL
FLEALLSAQQRLYISYIGRSVQDNSERYPSVLVSELLEYIAQSHCLAQDVDRDVDSSAER
VMAHLCHTHPRVPFDADNFDPQGEFQSYASEWLPAASGQGVEHPPFATRLAPLPLEHLTL
DMLIRFYRHPVRAFFQQRLGVSFIREESELPQEEPFTLDALSRYQINQLLLNRLVGGDEV
ETLYRQIRAAGTLPFGAFGELWWQAQRDEMTQLAQRVGDLFQPGESLEIDHTLDGCRLTG
WLPQAQASGLVRWRPAELGATDGIVLWIEHLLFCLAQGGGDSWMFGRKNTTWHFAGLDAA
QAERELVRLIEGYREGMQAPLLLTRSGWQWLKCCYDKETGQLQTTDEARLVKAHGSLLQA
WNGDAFSPGEGQDAYLQRVVRTLDDAAQRELEALAQRFYLPLLRHNLA
NT seq 3387 nt NT seq  +upstreamnt  +downstreamnt
atgtttaccgtttatcactccaatcaactggatgttctgacgcagctgatggcggcgctg
atgcaggggcagccgctggagacgccctttgaacgcgaggtgatcctggtgcaaagcccg
gggatgtcccagtggctgcagatggagctggcgcgcagcttcggcatcgccgccaatatc
gactttccgctgccggccacctttatctgggatctgtttacccgggtgctgccggatatt
ccgcagcgcagcgcctttagcaaagatgccatgacctggaagctgatgtggctgctaccg
cagttcctcgatcgcccggcgtttgccccgctggcgcactatctgagcgacgatacggat
cggcgcaagcattttcagctggcggcgcggattgccgacctgtatgaccagtatctggtc
taccgccccgagtggctgcagcgctgggagcaggggggactgatagaggggctggacagc
gcgcagcagtggcaggcgccgctgtgggtggcgctgcgtgactataccgagcagctgggc
cagccccagtggcaccgcgctaacctgtatcagcgcttcattcaggcgctgaaggtgagc
gatcgcgccccgccggggctaccgcgccgggtatttatctgcgggatctcggcgctgccg
ccggtctatcttgaggcgctacgcgcgctgggtgagcacatcgatgtgcatttgatgttc
actaacccctgtcgctactactggggcgatattcaggattatgcctttctggcgcggctg
caaagccggcgccgccgtgactatctgctggcgcagcgcagcctgggcgaaagccagagc
gcgctgtttcgcacgccggagcaggccgccgcgctgtttagcgaggagggcgagcaggcg
ctgagcaatccgctgctggcctcctggggcaagctgggacgcgatcatatgtatctgctg
gcccagcacggcccacaggaggtcagcgcctttgtcgacctggcgcaggagaccctgctg
cagcgcatccagcgagatatgctggagctggaggaccatgcctgtatcgccgccgcgggg
cagacgctgcaggatagtcggcagaagcggcggctggcgtcggacgatcgcagcatcagc
gtgcacgtctgccacagcccgcagcgcgaggttgaggtgctgcacgacagcctgctggat
atgttcgccgccgatgcaacgctgagcgcccgcgacgtgatcgtgatggtggccgatatc
gacagctatgcgccttttattcaggccgtcttcggcaatgcgccggccgggcgctatctg
cccttcgctatctcggaccgcagcgcccgccagctgcatccggtggtgcaggcgctgctg
gcgctgctcgatctgccccatagccgctttaacgccgagcaggtgttggcgctgctggag
gtgcctgcgctggcggcgcgttttgatatcgatgatgacggtatccggctgctgcgccac
tgggtggaggagtccgggatccgctgggggctggacgatgacgcggtgcgcgacttggcg
ctgccggcgaccggccagcatacctggcagtttggcctgacgcgcatgctgctgggctat
gccatggacagccgcagcggtgagtggcagggggtgctgccctacgatgagtccagcggg
acgatcgccgagctggccgggcaactggcgcagtttctggcggcgctgcgcgagtggcgc
cagcgcctggggcagatgcagacgctggcgcagtggcagccgctgtgccgggctctgctg
gaggacttttttgtcaccgacgccgatagcgaagcggtgtgcgcgctgatcgagcagcag
tggcttaagctgattgaagaggggctggcgtcggcctatcccgagacgctgccgatcacg
gtgctgcgtgacgagctgaccgcccgtctggataatcagcgcatcagtcagcgtttcctc
gccgggccgatcaacttctgcaccctgatgccgatgcgctccatcccgtttaaggtggtc
tgcctgctggggatgaacgacggcgtttatccgcgcaccctggcgccgctggggtttgat
ctgatggcggggaaagcgcagcgcggcgatcgcagccggcgtgacgatgaccgctacctg
tttctggaggcgctgctgtcggcgcagcagcgcctctatatcagctacattggtcgttcg
gtgcaggataacagcgagcgctatcccagcgtgctggtcagcgagctgctggagtatatc
gcccaaagccactgtctggcgcaggatgtggatcgggacgtggacagcagcgccgaacgg
gtgatggcgcacctgtgccatacgcacccgcgggtgccgtttgatgccgataacttcgat
ccgcagggcgagttccagagctatgccagtgaatggctgccggccgccagcgggcagggg
gtagagcatccaccgtttgccacccggctggcgccgctgccgctggagcacctgacgctg
gatatgctgatccgcttttaccgtcacccggttcgggccttttttcagcagcgtctgggg
gtcagctttatccgtgaggagagtgagctgccgcaggaggagccctttacgctggatgcg
ctcagccgctatcagatcaaccagctgctgcttaaccgcctggtcggcggcgatgaggtc
gagacgctgtatcgccagatccgcgccgccggaaccctgccctttggcgcctttggcgag
ctgtggtggcaggcgcagcgcgatgagatgacgcagctggcgcagcgggtcggcgatctg
ttccagccgggggagagcctggagattgaccatacgctggacgggtgtcgtctgaccggc
tggctgccgcaggcgcaggcgtcagggttggtgcgctggcgtcccgcagagctgggcgcg
acggacgggatcgtgctgtggatagagcacttgctgttttgcctggctcaggggggcggc
gatagctggatgtttgggcgcaagaatacgacatggcactttgccggactcgatgcggcg
caggccgagcgcgagctggtgcgcctgatcgagggctaccgcgaggggatgcaggcgccg
ctgctgctgacgcgcagcggatggcaatggctgaagtgctgttatgataaggaaacggga
cagctacagacgacggacgaggcccggctcgtcaaggcgcacggcagtctgctgcaggcg
tggaatggggatgccttcagccccggcgaggggcaggatgcctatttgcagcgggtggtg
cgtacgctggatgacgcggcgcagcgagagctcgaagcactggcgcagcgcttttattta
ccgctgctgcgtcataatttggcgtga

DBGET integrated database retrieval system