KEGG   Edwardsiella tarda FL6-60: ETAF_0654Help
Entry
ETAF_0654         CDS       T02091                                 

Gene name
recD
Definition
(GenBank) Exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:etd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ETAF_0654 (recD)
Enzymes [BR:etd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ETAF_0654 (recD)
DNA repair and recombination proteins [BR:etd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     ETAF_0654 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD Viral_helicase1 AAA_11 AAA_22 UvrD-helicase PhoH UvrD_C DUF2075 AAA_16 AAA_28 AAA_29 T2SSE CbiA
Motif
Other DBs
NCBI-ProteinID: ADM40776
UniProt: A0A0H3DQM8
Position
768026..769879
Genome map
AA seq 617 aa AA seqDB search
MRESLLSQMAQQRTLRPLDLQFATLLAGPQQPHLALAAALVSQELAAGHVCLPLTALDTA
TLSQRFPQQADAWPALLAGWDVARWRDYLLAQPCVSGGDRATPLVVSHDCLYLQRLWRDE
GTVAAFFAAACAQPRRVDGALAPVLHRLFPATAQRPDWQQVAAAVAVTRRASVISGGPGT
GKTTTVARLLAALVALAPGRMPRIQLAAPTGKAAARLGESLGQALAALALAPDQLQAMPR
EALTLHRLLGARADSARLRYHRDNPLHLDVLVVDEASMVDLPMMARLIEALPPQAQLILL
GDRDQLASVEAGAVLGELCRFAEYGFSAARAAELSQLCDAPIPAGETQPAVALRDAISLL
RHSYRFDARSGIGQLALAVNRGDRRMAMACLADRFADLHWHEIAQDEDYQTLLTCCLAGY
RPMLEGILRGEAPAQILAKFARFRPLCALREGPFGLHGLNERIALTLQRAGLIRRAHEGQ
KHWYAGRPVMITRNDASQALFNGDIGITLGDEQSGWQVWFMGSDGAPRAVQPNRLPPHET
AWAMTVHKSQGSEFDHTLLALPTQPSPVVTRELVYTAITRARQQLTLFATQPVLERAIRT
PTERRSGLMARLLAAAD
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagtctctactctcccagatggcgcagcagcgtacgctgcgcccgctggatctg
cagtttgccacgctgttagccgggccgcagcagccgcacctggcgctggccgcggcgctg
gtcagccaagagctggccgccgggcatgtctgcctgccgctgacggcgctggatacggcg
acgctgagccagcgctttccgcagcaggccgatgcgtggccagcgctgctcgccgggtgg
gacgttgctcgctggcgggactacctgctggcgcagccctgcgtcagcggtggcgatagg
gcgacgccgctggtggtcagccacgattgcctgtatctacagcgactatggcgtgatgag
ggcacggtggcggcctttttcgccgcggcctgtgcgcagccgcggcgcgtcgatggcgcg
ctggcgccggtgctgcaccgtctgttcccagccacggcccagcggccggactggcagcag
gtggccgcggccgtggcggtgacgcgccgggcgtcggtgatctccggcgggcccggcacc
ggtaaaaccacgaccgtagcgcgcctgctggcggcgttggtcgcgctggcgcccggtcgg
atgccgcgtattcagttggcggcgccgacgggcaaggcggcggcgcgtctgggtgagtcg
ctggggcaggccttggcggcattggcgctggcgccggatcagctgcaggcgatgccgcgc
gaagcgctgacgctgcatcggctgctgggtgcccgggcagacagcgcccgcttgcgctat
caccgggataatccgctgcatctggatgtgctggtggtggatgaggcttcaatggtggat
ctgccgatgatggcgcggctgatcgaggcgttgccgccgcaggcgcagctgatcctgctg
ggggatcgcgatcagctggcgtcggtggaggccggcgcggtgctgggtgagctgtgccgc
tttgccgaatatggcttcagcgccgcgcgcgcggccgagctgagccagctgtgcgatgcg
ccgatccccgccggagagacgcagccagcggtcgccctgcgtgacgccatcagcctgctg
cgtcacagctaccgcttcgacgcccgttcagggatcgggcagctggcgctggccgtcaat
cggggcgatcgccggatggctatggcgtgtctggcggaccgctttgccgatctgcattgg
cacgaaatcgctcaggatgaagactaccagacgctcttaacgtgctgtctggcggggtat
cgcccgatgctggaggggatcctgcgcggggaggccccggcgcagatcctggccaaattt
gcccgcttccgtccgctgtgcgccctgcgcgaggggccctttggcctacatggtctcaac
gagcgtatcgctctgacgctgcagcgggcggggctgatccggcgcgcgcatgaggggcaa
aagcactggtatgccgggcgtccggtgatgatcacccgcaacgacgccagtcaggcgctg
tttaacggcgatatcggtattacgctgggcgatgaacagagcggctggcaggtgtggttt
atgggcagcgacggcgcgccgcgcgcggtacagcccaaccgtctaccgccccatgagacg
gcctgggcgatgacggtgcacaagtcgcagggatcggagttcgaccatacgctgctggcg
ctgccgacccaaccgtcgccggtggtgacgcgtgagctggtgtataccgccatcacgcgg
gcgcgccagcagctgacgctctttgcgacccagccggtgctggagcgggccatccgtacg
ccgaccgaacggcgcagcgggctgatggcccgtctgctggccgccgccgattaa

DBGET integrated database retrieval system