KEGG   Edwardsiella tarda FL6-60: ETAF_1106Help
Entry
ETAF_1106         CDS       T02091                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd00450  Selenocompound metabolism
etd00970  Aminoacyl-tRNA biosynthesis
etd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ETAF_1106
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ETAF_1106
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:etd01007]
    ETAF_1106
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:etd03016]
    ETAF_1106
Enzymes [BR:etd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ETAF_1106
Amino acid related enzymes [BR:etd01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ETAF_1106
Transfer RNA biogenesis [BR:etd03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ETAF_1106
 Prokaryotic type
   Other AARSs
    ETAF_1106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ADM41220
UniProt: A0A0H3DRM8
Position
complement(1279729..1281777)
Genome map
AA seq 682 aa AA seqDB search
MASVTDTTGSRKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGNQVHFICADDAH
GTPIMLKAQQMGIAPEQMIAEVSKEHQQDFADFQISYDNYHSTHSEENRQLASLIYTRLK
ENGFIKNRTISQLYDPEKGMFLPDRFVKGTCPKCQSADQYGDNCEVCGATYSPTELINPK
SVVSGATPILRESEHFFFDLPSFGAMLQAWTRSGALQEQVANKMQEWFESGLQQWDITRD
APYFGFEIPDAPGKYFYVWLDAPIGYMGSFKNLCDKRGDLNFDDYWGKESDAELYHFIGK
DIVYFHSLFWPAMLEGSGFRKPSNVFVHGYVTVNGAKMSKSRGTFIQARTYLNHLDPDCL
RYYYAAKLSDRIDDIDLNLEDFVQRVNADIVNKVVNLASRNAGFITKRFDGQLSDTLADP
ALYQTFVDAAAEIAKAYEARESGKAIREIMALADLANRYVDEQAPWVVAKQEGRDADLQA
ICSMGLNLFRVLMTYLKPVLPALSARTEAFLNAELRWDAIAEPLLGHRVNPFKALFNRIE
MSKVDAMIEEGKLAAAAAAKPAVSGPLADDPIQDTITFDDFAKVDMRIAQIVSADRVEGS
DKLLKLQLDLGGETRQVFSGIRSAYPDPQALVGRLTVMVANLAPRKMRFGISEGMVMAAG
PGGKDIFLLSPDSGALPGQQVK
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagtcactgatacaacaggatcacgcaaaattctggtgacctgtgcgctccct
tacgctaacggctccattcacctcggccacatgcttgagcatattcaggcggacgtgtgg
gtgcgttaccagcgaatgcgcggcaatcaggtgcactttatctgcgccgatgatgcgcac
gggacgccgatcatgctgaaagcccagcagatggggatcgcgccggagcagatgatcgcc
gaggtcagcaaagagcatcagcaggattttgccgacttccagataagctatgacaactat
cactcgacccacagtgaagagaaccgtcagctggcgagcctgatctatacccgtctgaaa
gagaacggcttcattaagaaccgcaccatctctcagctctacgatccggaaaaggggatg
ttcctgccggaccgtttcgttaagggcacctgtcccaagtgccagtccgccgatcagtac
ggcgacaactgcgaagtgtgcggcgccacctacagccccaccgagcttatcaacccgaag
tccgtggtctccggcgcgacgcctatcctgcgtgaatcggagcacttcttcttcgatctg
ccatccttcggcgcgatgctgcaggcgtggacccgctccggcgccctgcaggagcaggtg
gccaataaaatgcaggagtggtttgagtccggcctgcagcagtgggacatcacccgcgat
gcgccttactttggctttgagatccccgatgcgccgggcaaatatttttacgtctggctg
gatgcgcccatcggctatatggggtcattcaagaatctgtgcgacaagcgcggcgacctg
aactttgatgattactggggtaaagagagcgacgccgagctgtaccactttatcggcaag
gacatcgtctacttccacagcctgttctggccggccatgctggaaggcagcggcttccgt
aagccgagcaacgtctttgtacacggctacgtcaccgtcaacggtgccaagatgtccaaa
tcgcgtggcaccttcattcaggcgcgtacctacctgaatcatctggatccggactgcctg
cgctactactatgccgccaagctctccgatcgtatcgacgacatcgatctgaacctggag
gactttgttcagcgcgtcaacgccgatatcgtcaacaaggtggtcaacctggcctcgcgc
aacgctggctttattaccaagcgcttcgacggccagctctccgataccctggccgatccg
gcgctgtaccagacctttgtcgatgcggcggcagagatcgccaaagcctacgaggcgcgc
gagtcgggtaaggcgatccgcgagatcatggccctggccgatctggccaaccgctatgtc
gatgagcaggcgccgtgggtggttgccaagcaagaggggcgcgatgccgatctgcaggcc
atctgctccatgggcctcaatctgttccgcgtgctgatgacctacctcaagccggtgctg
ccggcgctgagcgcgcgcaccgaggccttcctcaacgcagagctgcgctgggacgctatc
gccgaaccgctgctcggccaccgggtaaacccgttcaaggccctgtttaaccgcattgaa
atgagtaaagttgacgccatgattgaagaaggcaaactcgccgccgctgccgcggcgaaa
cccgccgtcagcggcccgctggctgacgatcccatccaggacaccatcaccttcgacgac
ttcgccaaggtggatatgcgcatcgcccaaatcgtcagcgccgatcgggtggaaggctcc
gacaagctgctgaagctgcagctggatctgggcggcgaaacccgccaggtcttctccggt
atccgcagcgcctaccctgatccgcaggcactggtcggccgtctgacggtgatggtcgcc
aacctggcgccgcgtaagatgcgcttcggcatctccgaaggcatggtgatggccgcaggc
ccgggcgggaaggatatcttcctgctcagccctgacagcggcgccctgccgggccagcag
gtgaagtaa

DBGET integrated database retrieval system