KEGG   Edwardsiella tarda FL6-60: ETAF_1321Help
Entry
ETAF_1321         CDS       T02091                                 

Definition
(GenBank) Arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:etd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ETAF_1321
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:etd01007]
    ETAF_1321
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:etd03016]
    ETAF_1321
   03029 Mitochondrial biogenesis [BR:etd03029]
    ETAF_1321
Enzymes [BR:etd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     ETAF_1321
Amino acid related enzymes [BR:etd01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   ETAF_1321
Transfer RNA biogenesis [BR:etd03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ETAF_1321
 Prokaryotic type
   Other AARSs
    ETAF_1321
Mitochondrial biogenesis [BR:etd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ETAF_1321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N tRNA-synt_1e tRNA-synt_1g tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: ADM41433
UniProt: A0A0H3DSH7
Position
complement(1529516..1531249)
Genome map
AA seq 577 aa AA seqDB search
MNIQAIISDKVTQALVAAGAPADSEALVRPSAKVQFGDYQANGIMAAAKKMGLPPRQLAE
QVVANLALDGIASKVEIAGPGFINIFLDAAWLAAQADAALADPRLGVARVEPQTIVVDYS
APNVAKEMHVGHLRSTIIGDAAVRTLEFLGHNVIRANHVGDWGTQFGMLIAYLEKVQGSS
KTGDMALADLEAFYREAKKHYDEDAAFAERARGYVVKLQGGDEYCREMWRKLVDITMRQN
QRNYDRLNVTLTDDDVMGESLYNPMLPGIVADLKAKGLATESEGATVVFLDEFKNKEGEP
MGVIVQKKDGGYLYTTTDIACAKYRYETLGANRILYYIDSRQHQHLMQAWAIVRKAGYVP
DSVSLEHHMFGMMLGKDGKPFKTRAGGTIKLADLLDEAIERAAKLIAAKNPELSGDELKA
LVEVVGIGAVKYADLSKNRTTDYIFDWDNMLAFEGNTAPYMQYAYTRVASIFKRAGIDEN
ALQGAITLTEDREKALATRLMQFEETILSVAREGTPHVMCAYLYEVAGLFSSFYEACPIL
NADEESVCASRLKLAALTARTLKTGLDTLGIKTVERM
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
gtgaatattcaggcaattatttcagataaagtcacgcaggcgctggttgctgccggtgcg
ccggccgacagcgaggccctggtccgtccctccgcgaaagtccagtttggcgactatcag
gccaatggcattatggccgcggcgaaaaaaatgggcctgcctccgcgacagctcgccgag
caagtcgtggccaatctggcgctggatgggatcgccagcaaggtagagattgccggtccg
ggtttcatcaatatcttcctcgatgccgcctggctagctgcgcaggccgatgccgcgctg
gccgatccgcgcctgggcgtggctcgcgtcgagccgcagaccatcgtcgttgactactcc
gcgccgaacgtcgccaaagagatgcacgtcggtcatctgcgctccaccatcattggcgac
gccgccgtacgcaccctggagttcctgggccacaacgttatccgcgccaaccacgtcggc
gactggggcacccagttcggtatgctgatcgcctacctggaaaaggtgcagggcagcagc
aaaaccggcgacatggcgctggccgatctggaagccttctaccgcgaagccaaaaagcac
tacgatgaagacgcggcctttgccgagcgcgcgcgcggctacgtggttaaactgcagggc
ggcgatgaatactgccgcgaaatgtggcgcaagctggtggatatcaccatgcgtcagaac
cagcgcaactatgaccgtctcaacgtgaccctgaccgacgatgacgtcatgggcgagagc
ctgtacaacccgatgctgccggggatcgtcgccgatctgaaagccaaagggctggcgacc
gaaagcgaaggcgccaccgtcgtcttcctggacgagttcaagaacaaagaaggtgagccg
atgggggtgatcgtccagaagaaggacggcggctacctgtacaccaccaccgatatcgcc
tgcgccaagtaccgttatgagaccctcggcgccaaccgtatcctgtactacatcgactcc
cgccagcatcagcacctgatgcaggcctgggccatcgtacgcaaggccggctatgtgccg
gactccgtcagcctagagcaccacatgttcggcatgatgctgggtaaagacggcaagccg
ttcaagacccgcgccggcggcaccatcaagctggccgatctgctggatgaagccatcgag
cgcgccgccaagctgatcgccgccaagaacccggagctgagcggcgacgagctgaaggcg
ctggtagaagtggtcggtatcggtgcggtcaagtatgcggatctctccaaaaaccgcacc
accgactatatctttgactgggacaacatgctggccttcgagggcaacaccgccccttac
atgcagtatgcctatacccgcgtcgcctccatcttcaagcgcgccggcatcgatgaaaat
gccctgcagggcgccattacgctgacggaagatcgtgaaaaggcgctggccacccgcctg
atgcagtttgaagagacgatcctgagcgttgcgcgtgagggaaccccgcacgtcatgtgc
gcctacctgtacgaagtcgccggcctgttttccagcttctatgaggcctgcccgatcctc
aacgccgacgaggagagcgtgtgcgccagccgcctgaagctggccgccctgacggcccgt
acgctgaaaaccggtctggacaccctggggatcaagacggtcgagcgtatgtaa

DBGET integrated database retrieval system