KEGG   Edwardsiella tarda FL6-60: ETAF_1398Help
Entry
ETAF_1398         CDS       T02091                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd00010  Glycolysis / Gluconeogenesis
etd00071  Fatty acid degradation
etd00350  Tyrosine metabolism
etd00620  Pyruvate metabolism
etd00625  Chloroalkane and chloroalkene degradation
etd00626  Naphthalene degradation
etd00650  Butanoate metabolism
etd01100  Metabolic pathways
etd01110  Biosynthesis of secondary metabolites
etd01120  Microbial metabolism in diverse environments
etd01130  Biosynthesis of antibiotics
etd01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAF_1398
   00620 Pyruvate metabolism
    ETAF_1398
   00650 Butanoate metabolism
    ETAF_1398
  Lipid metabolism
   00071 Fatty acid degradation
    ETAF_1398
  Amino acid metabolism
   00350 Tyrosine metabolism
    ETAF_1398
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ETAF_1398
   00626 Naphthalene degradation
    ETAF_1398
Enzymes [BR:etd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ETAF_1398
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ETAF_1398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 HTH_AsnC-type
Motif
Other DBs
NCBI-ProteinID: ADM41510
UniProt: A0A0H3DQ44
Position
complement(1609519..1612191)
Genome map
AA seq 890 aa AA seqDB search
MAVTNTAELDALVARVKKAQREFANFSQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGILSEDDTFGTITIAEPTGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKQATNKAADIVLQAAIAAGAPKDIIGWIDEPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASILMSKTF
DNGVICASEQSVIVVDAVYDKVRERFATHGGYLLQGKELKAVQDIILKNGALNAAIVGQP
AEKIAEMAGISVPAGTKILIGEVSVVDDSEPFAHEKLSPTLAMYRAKNFEDAVEKAEKLV
AMGGIGHTSCLYTDQDNQGARVNYFGEKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGALPIALEEVATDGAK
RAFIVTDRFLFNNGYADQVTNVLKAHGIETEVFFEVEADPTLSIVRKGAEQMNSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHALE
AYVSVLANEYSDGQALQALKLLKEFLPASYAEGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANALLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAQKIEKLLAWLESIKAELGIPASIREAGVQEADFLAKVDKLSEDAFDDQ
CTGANPRYPLIAELKQILLDTYYGREFVEHAQEESKTVAAPKAEKKAKKA
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaccaacactgctgaactcgatgcgctggtcgcccgtgtcaaaaaagcccaa
cgcgagtttgccaacttctctcaggaacaggtagacaaaatcttccgcgccgccgctctg
gccgctgccgatgcccgtattccgctggctaaaatggccgtcgctgaatccggcatgggt
atcgtggaagataaggtgatcaaaaaccacttcgcctccgaatatatctacaacgcctat
aaagatgaaaagacctgcggcatcctgtccgaagacgataccttcggcaccatcaccatc
gccgagccgaccggcctgatctgtggcatcgtaccgaccaccaacccgacctctaccgcg
atcttcaaggcgctgatcagcctgaagacccgcaacggcatcatcttctccccgcatccg
cgcgccaagcaggcgaccaacaaagccgccgatatcgtgctgcaggctgccatcgccgcc
ggcgcaccgaaagacatcatcggctggatcgatgagccgtccgtcgagctgtccaacgcg
ctgatgcaccatccggacatcaacctgatcctggccaccggtggcccgggcatggttaaa
gcggcctatagctccggcaaaccggccatcggcgttggcgccggcaacaccccggtcgtg
atcgacgaaaccgcggatatcaagcgcgccgtcgcctctatcctgatgtccaaaaccttc
gataacggcgttatctgtgcttccgagcagtctgttatcgtcgttgacgccgtctacgat
aaggttcgcgagcgtttcgctacccacggcggctacctgctgcaggggaaagagttgaaa
gccgttcaggatatcatcctgaagaatggcgcgctgaacgccgccatcgtaggccagccg
gcagagaagatcgccgaaatggccggcatcagcgtaccggcagggaccaagatcctgatc
ggcgaagtcagcgtcgttgacgactccgagccgttcgcccacgaaaaactgtctccgacc
ctggccatgtaccgcgccaaaaacttcgaagacgccgtcgagaaagccgagaaactggtt
gccatgggcggtatcggtcatacctcctgcctgtacaccgaccaagataaccagggtgcg
cgcgtaaactacttcggcgagaagatgaagaccgcccgtatcctgatcaataccccggcc
tctcaagggggtatcggtgacctgtacaacttcaagctggcgccttccctgacgctgggc
tgcggctcctggggcggtaactccatctctgaaaacgtgggtccgaagcacctgatcaac
aagaaaacggtagcgaagcgagcagaaaacatgttgtggcataaacttccgaagtctatc
tacttccgccgcggcgccctgccgatcgcgctggaagaagtggcaaccgacggtgccaag
cgcgcctttatcgtcaccgaccgtttcctgttcaacaacggttatgccgaccaggttacc
aacgtactgaaagcacacggtatcgaaaccgaagtcttcttcgaagttgaagccgatccg
accctgagcatcgtgcgcaaaggcgccgaacagatgaactccttcaagccggacgtgatc
atcgcgctgggcggcggctccccgatggatgcggccaaaatcatgtgggtgatgtacgag
catccggaaacccacttcgaagagctggcgctgcgctttatggatatccgtaagcgtatc
tacaagttcccgaaaatgggcgtcaaagccaagatgatcgccatcaccaccacctctggc
accggctctgaagtaacgccgttcgccgtggtgaccgacgacgcgaccgggcagaaatac
ccgctggctgactatgcgctgacgccggacatggccatcgttgatgccaacctggtgatg
aatatgccgaaatccctgtgcgccttcggcggtctggatgcggtaacccatgcgctggaa
gcctacgtttccgttttggccaacgaatactctgacggccaggcactgcaggctctgaaa
ctgctgaaagagttcctgccggccagctatgccgaaggcgctaaaaacccggtagcccgc
gagcgtgtgcacaacgccgccactatcgccggcatcgcgtttgccaacgccttcctcggg
gtatgtcactccatggcccacaaactgggctccgagttccacattccgcacggtctggcc
aacgccctgctgatctcgaacgttattcgctacaacgcgaacgacaacccgaccaagcag
accgcgttcagccagtacgaccgtccgcaggcgcgtcgtcgttacgctgaaatcgcagac
cacctgggtctgagcgcaccgggcgaccgcaccgcgcagaagatcgagaagctgctggcc
tggctggagagcatcaaggctgaactgggtatcccggcctccatccgtgaagccggcgta
caggaagccgacttcctggcgaaagtggacaagctgtccgaagatgctttcgacgatcag
tgcaccggcgccaacccgcgctatccgctgattgccgaactcaagcaaattctgctggac
acctactatggccgcgagttcgtcgagcacgcgcaggaagaaagcaagaccgttgccgcg
ccgaaagcggaaaagaaggccaaaaaagcctga

DBGET integrated database retrieval system