KEGG   Edwardsiella tarda FL6-60: ETAF_1993Help
Entry
ETAF_1993         CDS       T02091                                 

Gene name
trxB
Definition
(GenBank) thioredoxin reductase (NADPH)
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:etd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ETAF_1993 (trxB)
Enzymes [BR:etd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     ETAF_1993 (trxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like FAD_oxidored FAD_binding_2 K_oxygenase NAD_binding_7 AlaDh_PNT_C NAD_binding_8 FMO-like Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: ADM42099
UniProt: A0A0H3DVX8
Position
2270364..2271335
Genome map
AA seq 323 aa AA seqDB search
MSSVKHCKLLILGSGPAGYTAAVYAARANLNPVLITGMEKGGQLTTTSELENWPGDPEGL
TGPLLMERMNQHAAKFNTEIILDHIQRVDLSQRPFRLFGDSQEYSCDALIVATGASARYL
GLPSEEAFKGRGVSACATCDGFFYRQQEIAVIGGGNTAVEEALYLANIAAKVHLIHRRDS
FRAEKILIDRLMDKVRSGNIVLHTNRTLDEVLGDDMGVNALRLKDTQSGACEELAVSGLF
VAIGHSPNTAIFDGQLTLNNGYIQVQSGLNGNATQTSVPGVFAAGDVMDHIYRQAITSAG
TGCMAALDAERYLDSLADAARHA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagctccgtaaaacattgcaagcttctcattctgggctcaggcccggcgggatacacc
gcggccgtctatgcggcgcgtgccaacctcaacccggtgctgatcaccggcatggaaaaa
ggcggtcagctcaccaccaccagcgagctggaaaactggccgggcgatccggaagggctg
accgggcctctgctgatggagcgcatgaatcagcatgcggccaaattcaataccgagatc
atccttgaccatatccagcgcgtggatctcagccagcgcccgtttcgtctgtttggcgac
agccaggagtacagctgcgacgcgctgatcgtcgccaccggcgcctctgcccgctatctg
ggcctgccgtcggaagaggcctttaaaggccgcggcgtctccgcctgcgccacctgcgat
ggctttttctaccgccagcaagagatcgccgtgatcggcggcggtaacaccgccgtagaa
gaggcgctgtacctggccaacatcgccgccaaggtgcatctgatccaccgccgcgacagc
ttccgcgccgagaaaatccttatcgaccgcctgatggacaaagtgcgcagcggtaatatc
gtcctgcacaccaaccggactctggacgaggtactcggcgatgatatgggcgttaacgcc
ctgcgtctgaaagatacccagagcggtgcctgcgaagagctggccgtcagcggcctgttt
gtcgcgatcggccacagcccgaacaccgctatcttcgatggccagctgacgctgaataac
ggctacattcaggtacagtccggtctgaacggcaacgcgacccagaccagcgtcccgggc
gtattcgccgccggcgacgtcatggaccatatctatcgtcaggcgatcacctctgccggg
accggctgcatggcggcgctggacgccgagcgctatctcgatagcctggccgatgccgct
cgccacgcctaa

DBGET integrated database retrieval system