KEGG   Edwardsiella tarda FL6-60: ETAF_2012Help
Entry
ETAF_2012         CDS       T02091                                 

Definition
(GenBank) Low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd00260  Glycine, serine and threonine metabolism
etd01100  Metabolic pathways
etd01110  Biosynthesis of secondary metabolites
etd01120  Microbial metabolism in diverse environments
etd01130  Biosynthesis of antibiotics
etd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:etd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAF_2012
Enzymes [BR:etd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     ETAF_2012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ADM42118
UniProt: A0A0H3DUM8
Position
2292689..2293741
Genome map
AA seq 350 aa AA seqDB search
MLDLRSDTVTRPSEAMRLAMSRAEVGDDVYGDDPSINRLEQEAAALSGKAAALFLPSGTQ
ANLVALLSHCQRGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDALPDGTLPLARVADVI
KPDDIHFARSRLLSLENTHNGKVLPLDYLAQAWAFSREKGLSLHIDGARIMNAAVALEVP
LTTLTQYCDTLTLCLSKGLGAPVGSLLCADADFIQRARRWRKMTGGAMRQAGILAEAGRY
ALRHNVERLRDDHANAAWLADALSSLGVRVLAPGAQTNMLFLQLEADEAAALGPWMRQRG
ILISAGTTTRLVTHLDVTRADLQRLVELWQTFRQTYRPANGAPHAHATYG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgttagatctgcgcagcgataccgttacccgcccgagcgaggccatgcgtctggccatg
tcacgcgccgaggtcggcgatgatgtctacggcgacgatcccagcatcaaccgcctggag
caggaggccgcagcgctgagcggcaaagcggcggcgctgtttctccccagcggaacccag
gccaacctggtggcactgctgagccactgtcagcgcggcgaggagtatatcgtcggccaa
aaggcgcataactacctgtatgaggccggcggcgcggcggtgctcggcagtatccagccc
cagcccatcgacgccttgcccgacggcaccctgccgctggcgcgggttgccgacgtgatc
aagccggacgacattcactttgcccgcagccgcctgctcagcctggagaatacccataac
ggcaaggtgctaccgctcgactatctggcgcaggcctgggcatttagccgcgaaaagggg
ctgagcctgcatatcgacggcgcccgtatcatgaacgccgcggtggcccttgaggtgccg
ctgacgaccctgacccaatactgcgataccctcaccctctgcctctccaaggggctgggg
gcgccggtcggctcgctgctgtgcgccgacgccgactttattcagcgcgcgcgccgctgg
cgtaaaatgaccggtggcgccatgcgtcaggccggtattctggccgaggcagggcgttac
gcgctgcgtcataacgtcgagcgtctgcgcgacgatcacgctaacgccgcctggctggcc
gacgcgctctcctccctgggagtccgggtgctggcgccgggtgcccagacaaatatgcta
tttttacagttggaggccgatgaggccgccgcgctgggcccctggatgcgccagcgcggg
atcctgatcagcgcgggcacaaccacgcggctggtgacccatctggacgtcacccgcgcc
gacctgcagcggctggtcgaactgtggcaaaccttccgccagacctaccgtccggcgaac
ggtgcgccgcacgcccacgccacctacggctaa

DBGET integrated database retrieval system