KEGG   Edwardsiella tarda FL6-60: ETAF_2198
Entry
ETAF_2198         CDS       T02091                                 

Gene name
evpP
Definition
(GenBank) type VI secretion system protein EvpP
Organism
etd  Edwardsiella tarda FL6-60
SSDB
Other DBs
NCBI-ProteinID: ADM42303
UniProt: A0A0H3DV20
Position
2505588..2505890
AA seq 100 aa
MLIAKQNGVSMREWGRLTSVIKENWSSLDFLLEIVLKIPVYAWFGGFKGMSRIDNGMTSK
RNITLEQKGRSSMLPGGATQFYIPNLTVGHISSHQFSILK
NT seq 303 nt   +upstreamnt  +downstreamnt
atgctgatcgctaagcaaaacggggtatcaatgagggaatggggacgactcacctccgtg
atcaaagaaaactggagctctctcgactttttacttgagatagtcctaaagattcccgtc
tatgcctggttcggtggatttaagggcatgtcgcgcattgataatggtatgacctctaaa
cgaaatatcacgctggaacaaaaaggccggagctcaatgctccccggcggggccacacag
ttctatattccaaacctgacggtcgggcatatcagtagccaccaattttcaatattgaaa
tag

DBGET integrated database retrieval system