KEGG   Edwardsiella tarda FL6-60: ETAF_2207
Entry
ETAF_2207         CDS       T02091                                 

Gene name
evpI
Definition
(GenBank) type VI secretion system protein EvpI
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:etd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ETAF_2207 (evpI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:etd02044]
    ETAF_2207 (evpI)
Secretion system [BR:etd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ETAF_2207 (evpI)
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Sarcoglycan_1
Other DBs
NCBI-ProteinID: ADM42312
UniProt: A0A0H3DUI4
Position
2516085..2518070
AA seq 661 aa
MGLTSDSRLLSLSTPLGKDALQVVQCRGEEAIADLYRFELELFSTDPALAWQSLVGQAAA
LRLALPNGQTRYWHGVIGRAAYRGAEQHGFAYYAELVPRLAWLQHAQECQIFQEKTVPQI
IEAVLKARGISDFRLSLSQRYAPREYCVQYRESDLSFISRLMEEEGIFYWFEHSESRHVL
VLADGNAAVQPCKVRSDIVYRPKHRSESGDDIQWWMPSLAVVPANVFLNAYTFEQPTAHL
LTSSASVAKQGKLSDVAVYDFTDDYTQTREGERRAKLKMEGLEAMQARIEGGGRCRTLAP
GYGFSLQKHFRKDCNGDYLLLSVRHEIVNNLPWQEQEVNYQNHFICLPKSLPYRTLSQTP
RPVIHGVQTAVVTGPQGEEIHTDRHGRVKVHFHWDRLGTQDDKSSCWIRVAQGWAGLGWG
GMQLPRVGQEVIVDFVDGNPDAPLITGRVYNAHQTPPFKLPDNKTQSGIQTRSTPNGNPE
HFSLLRFEDKMGAEEVFMQAERDFRRRVKHDDELTVEHDRRVTIKNDCAETVSEGNYLQS
ITKGKHTRVIEGDALTEVKSGNSTLQVNKGDHATTASAGSLHLKAGTAITLSVGSNRIVI
DSGGVLIEGMNITVKGKQSIALSGLSVAITGTQSASLSSSAEAEVSSSVMTSIKGGIVKI
N
NT seq 1986 nt   +upstreamnt  +downstreamnt
atgggattaacgtcggatagccggctgttgtccttgtccaccccgctgggcaaggatgcc
ttacaggtggtgcagtgccggggcgaagaggcgatcgccgatctctaccgctttgagctg
gagctgttctccacggaccccgcgctggcgtggcaatcgctggtcgggcaggccgccgcg
ctgcggctggccttgccgaatggccagacccgctactggcatggcgtgatcggccgggcc
gcctaccggggcgccgagcaacacggatttgcctattatgccgagctggtaccgcgcctg
gcctggctgcagcacgcccaggagtgtcagatcttccaggagaagacggtcccgcagatt
attgaagcggtgcttaaggcgcggggcatcagcgattttcgcctctcgctgtcgcagcgc
tacgccccccgggaatactgcgtacagtatcgcgaatcggacctcagcttcatcagccga
ctgatggaggaagagggcattttctactggttcgaacacagcgaaagccgccatgtgctg
gtattggccgatggcaatgccgcggtccaaccctgcaaggtgcgctcagacatcgtctat
cgacctaagcataggagcgaatccggcgatgatatccagtggtggatgccctccctcgcg
gtcgtgccggccaacgtcttcctgaatgcctatacctttgagcagccgaccgcccatttg
ctgacctccagcgcctccgtggccaagcagggcaaattgagcgacgtggcggtctacgat
ttcaccgatgactatacgcagacccgggagggcgaacgccgcgccaagctgaagatggag
gggctagaggccatgcaggcccggatagagggcggcggacgctgccgcacgctggcgccg
ggctatgggttcagcctgcaaaaacatttccgcaaagactgtaacggtgactatctgctg
ctaagcgtacggcacgagatcgtcaacaacctgccgtggcaggagcaagaggtgaactac
cagaaccactttatctgtctccccaaatccctgccctaccgcaccctaagccaaacgccc
cgcccggtgatccatggcgtacagactgccgtggtcaccggtccgcagggcgaggagatc
cataccgatcggcatggccgggttaaggttcattttcactgggatcgcctgggaacgcag
gatgataaaagctcctgctggatccgggtggcgcagggctgggccgggctgggctggggg
gggatgcagctgccccgcgtagggcaggaggtgatcgtggattttgtcgatggcaatccg
gacgcccccctgatcaccggccgggtctataacgcccaccagacgccccccttcaagctg
cctgacaataagacccaaagcggtattcagacccgcagcacccccaatggcaatccggag
cacttcagcctgctgcgcttcgaggacaagatgggggcggaagaggtgttcatgcaggcg
gagcgggattttcgccgccgggtgaaacacgatgacgaactgacggtcgagcacgaccgc
cgggtgaccatcaagaatgactgcgccgagacggtctccgaggggaactacctgcagagc
atcaccaagggcaagcatacccgggtgatcgagggcgatgccctcacggaggtgaagtca
ggcaacagtacgctgcaggtgaacaagggggatcacgccaccaccgcctcggcgggcagc
ctccatctgaaggcaggaaccgcgataaccctgagcgtgggcagcaatcgtatcgtcatt
gacagcggcggcgtgctcatcgagggcatgaatatcacggtgaaggggaaacagtccatt
gcgctatccggcctcagcgtcgcgataacgggcacccaatcggccagcctgagcagttcg
gcagaggcggaggtctcctcgtccgtgatgacctccatcaagggcggtattgtcaagatc
aactga

DBGET integrated database retrieval system