KEGG   Edwardsiella tarda FL6-60: ETAF_2815Help
Entry
ETAF_2815         CDS       T02091                                 

Definition
(GenBank) L-seryl-tRNA(Sec) selenium transferase
  KO
K01042  L-seryl-tRNA(Ser) seleniumtransferase [EC:2.9.1.1]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd00450  Selenocompound metabolism
etd00970  Aminoacyl-tRNA biosynthesis
etd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ETAF_2815
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ETAF_2815
Enzymes [BR:etd01000]
 2. Transferases
  2.9  Transferring selenium-containing groups
   2.9.1  Selenotransferases
    2.9.1.1  L-seryl-tRNASec selenium transferase
     ETAF_2815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SelA Se-cys_synth_N Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ADM42917
UniProt: A0A0H3DUG4
Position
3223680..3225071
Genome map
AA seq 463 aa AA seqDB search
MSSDHQALYSQIPAIDTLLRTPACAALQAQYGSQLVTQTLRSLQQQARHAVQRQQALPDW
CADWGQACAQRLAETLRPALRRVFNLTGTVLHTNLGRALLPDPAIAAAAESMSAPVTLEY
DLDDAGRGHRDRAIADRLCALTGAEDACIVNNNAAAVLLMLATLAPGRDVIVSRGELVEI
GGAFRIPDVMTQAGCRLREVGTTNRTHLHDYRQAIDEHSALLMKVHTSNYAIAGFTAAVS
EAELAALGHEYGLPVISDLGSGSLLDMASYGLPAEPMPQRMLADGVDLVSFSGDKLLGGP
QAGIIVGRRELIRRLQRHPLKRALRCGKMTLAALDATLQLYQQPEKLRQALPTLRHLTRE
ASEIAACGERLLARLRPRYEAAFILTLEPCLSQIGSGSLPVDRLPSHALTLTPRDGRGGT
LTALAERWRALPRPVIGRLQEGKLWLDLRCLDDEQALLQELCQ
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgagttcagatcatcaggcgctttacagccaaatccccgcgatcgataccctgctgcgc
acgcccgcgtgcgcagccctacaggcgcagtatggcagtcagctggtaacccagaccctg
cgctcgctgcagcagcaggcccgtcacgccgtccagcggcagcaggcgctgcccgactgg
tgcgccgactggggacaggcctgcgcccagcgcctggccgaaacgctgcgaccggccctg
cgccgggtctttaacctgaccggcaccgtcctgcacaccaacctgggccgggcgctactg
cccgatccggcgatcgcggcggcggccgagtcgatgagcgccccggtcaccctggagtac
gatctggacgacgcggggcgcggccaccgcgatcgcgcgatcgccgatcggctgtgcgcc
ctgaccggcgccgaagacgcctgtatcgttaacaacaacgcggcggcggtgctgctgatg
ctggcgaccctggcgccggggcgcgacgtgatcgtctcgcgcggcgagctagtggagatc
ggcggcgcgttccgtattcccgacgtcatgacccaggcgggatgccgtctgcgcgaggtc
ggcaccaccaaccgcacccacctgcacgactaccgccaggccatcgacgagcacagcgcg
ctattgatgaaggtgcacaccagcaactacgcgatcgcgggcttcaccgccgccgtcagc
gaggccgagctggccgccctaggccacgaatatggcctgccggtcatcagcgacctcggc
agcggatcgctgctggacatggccagctacggcctgccggccgagccgatgccacagcgc
atgctggccgacggcgtcgatctggtcagcttctccggcgacaagctgctcggcggcccc
caggcggggatcatcgttggccgccgagagctgatccgccgcctgcagcgccatccgctc
aagcgcgccctgcgctgcggcaagatgacgctggcggcgctggacgccacgctgcagctg
taccagcagccggagaagctgcgccaggcgctgcccaccctgcgccacctgacgcgagag
gcgagcgaaatcgccgcctgcggcgagcggctgctggcccgcctgcgcccgcgctatgag
gcggcgttcatcctgacgctggagccctgcctgtcacagatcggcagcggctcgctgccg
gtggatcgcctgccgagccatgcgctcaccctgaccccccgcgacggtcgcggcggcacc
ctgacggcgctggccgagcgctggcgcgcgctgccccgcccggttatcggacgcctgcaa
gagggcaaactgtggctcgatctgcgctgtctggacgatgagcaggcgctgctccaggag
ctgtgccaatga

DBGET integrated database retrieval system