KEGG   Edwardsiella tarda FL6-60: ETAF_3153Help
Entry
ETAF_3153         CDS       T02091                                 

Definition
(GenBank) probable haloacid dehalogenase-like hydrolase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd00010  Glycolysis / Gluconeogenesis
etd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:etd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAF_3153
Enzymes [BR:etd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     ETAF_3153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD PNK3P Acid_PPase SHOCT
Motif
Other DBs
NCBI-ProteinID: ADM43256
UniProt: A0A0H3DXI3
Position
complement(3610552..3611139)
Genome map
AA seq 195 aa AA seqDB search
MLYIFDLGNVIVDIDFHRVLGVWSRYSGAPLATLSKRFTMGDTFRQHERGAIDDETFAQR
LCDEMGISLSFAQFELGWQAIFVALRPEVIDIMQRLRRQGERVVVLSNTNRLHTHFWPKH
YPEIAAACDKMYLSQELGMRKPDAEIYRYVLEQERAAAGESVFFDDNADNVAAAKALGIQ
AVQVCDRQVIPAYFA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgctgtacatctttgatttaggtaacgtgattgtagacatcgattttcaccgtgtgctg
ggggtctggagccggtacagcggcgccccgctggccaccttaagcaagcgttttacgatg
ggcgacacctttcgacagcatgagcgcggggcgatagacgatgaaacctttgcccagcgt
ctgtgcgatgagatggggatctccctcagctttgcccagttcgaactgggctggcaggcg
attttcgtcgcgctgcgcccggaggtaatcgatatcatgcagcgcctgcgtcgtcagggg
gagcgggtcgtggtgctctccaataccaatcggctgcacactcacttttggcctaagcac
tacccggagatcgcggccgcctgcgataaaatgtacctgtcgcaggagctgggtatgcgc
aagcccgatgccgaaatctatcgctatgtcctggagcaggagcgggcggcggccggggag
tcggtcttctttgacgataacgccgacaatgtggcggcggcgaaggcgttggggatccag
gcggtacaggtgtgtgaccgtcaggtgatccccgcctattttgcataa

DBGET integrated database retrieval system