KEGG   Edwardsiella anguillarum: ETEE_2350
Entry
ETEE_2350         CDS       T03245                                 

Gene name
ygeU
Definition
(GenBank) Xanthine dehydrogenase iron-sulfur subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ete  Edwardsiella anguillarum
Pathway
ete00230  Purine metabolism
ete01100  Metabolic pathways
ete01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ete00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETEE_2350 (ygeU)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AIJ08792
UniProt: A0A076LQ10
Position
complement(2377734..2378219)
AA seq 161 aa
MNVKEWVEITCQINGKTYQFCVSPAMSLLEMLREHGLTSVKQGCSVGECGACSVLIDGVA
TDSCLYLALWADGKQIVTADGLGRADSLSPIQQAYVDAGAVQCGFCTPGLVVATHALLAK
PRSRPLTHQEIRRGLSGNLCRCTGYQAIVRAVDLCQREEDQ
NT seq 486 nt   +upstreamnt  +downstreamnt
atgaatgtcaaagaatgggttgaaatcacctgccagatcaatgggaaaacctatcagttt
tgcgtgtcgccggcgatgtcgctgctggaaatgctgcgcgagcacgggctaaccagcgtg
aagcagggctgcagtgtcggtgagtgcggcgcctgcagcgtattgatcgatggcgtggca
accgacagctgcctgtacctggcgctgtgggccgacggtaagcagatcgtcacggccgat
gggctgggccgagccgacagcctttcgccgatccagcaggcctatgtcgacgccggcgca
gtgcagtgtggtttctgtaccccgggactggtggtcgcgacccatgccctgctggcgaaa
ccgcgcagtcgcccgctgacgcaccaggagatccgccgcggcctctccggcaacctgtgc
cgttgcaccggctatcaggccatcgtacgcgccgtcgatctctgccagcgcgaggaagat
cagtag

DBGET integrated database retrieval system