KEGG   Edwardsiella anguillarum: ETEE_2352
Entry
ETEE_2352         CDS       T03245                                 

Gene name
ygeS
Definition
(GenBank) Xanthine dehydrogenase, molybdenum binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
ete  Edwardsiella anguillarum
Pathway
ete00230  Purine metabolism
ete01100  Metabolic pathways
ete01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ete00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETEE_2352 (ygeS)
Enzymes [BR:ete01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     ETEE_2352 (ygeS)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AIJ08794
UniProt: A0A076LT61
Position
complement(2379101..2381392)
AA seq 763 aa
MSLGSPLRRVDAEAKVTGQARYTDDMMMPGMLHACYVRSRIAHGNVTAIDTREAESMPGV
EAVFTFHDVPSAPFPTAGHAWSLEPGKRDIADRHLLTGHVRHFGDGVAIVVARDLLSAER
AAARVQVSYDALPVITRPQAALADGAPAIHPGGNLLRHSEIDAGEPEARIAAADLQLEGH
YETPVVQHCHMEGVTCYAYMEQPDHIVIVSSTQIPQIVRRTVAQALGLPWSHVRVIKPYV
GGGFGNKQDVLEEPMAAFLTQRLGGKPVKVSLSREECFVATRTRHAFSIDARLGMRRDGQ
LEGYRLTVLSNTGAYASHGHSIAAAGANKISYLYPRSAFGYCADTVYTNLPAAGAMRGYG
APQVDFALECLMDDAAARLDLDPLEVRLRNVARQGDRNPVNGKSIYSAGLTECLEKGRRL
FEWDRRRAECMAQSADAPVRRGVGVACFSYGSNTYPVGVEIAGARLLLNQDGTVNLQIGA
TEIGQGSDTVFAQMASETLGIPFKQIRVISTQDTDITAFDPGAFASRQSYVAAPAIRRSA
EIMRQKILAHAALISHQPEWGLTLCDGNVVMAMQPDQVLMSVADVAMQAYYHQEIGAQIL
AEVSHKTTTNPPAFGCTFVDLSIDIALCQVTINRILNLHDSGRILNPQLAEGQVHGGMGM
GIGWALFEEMIIDEKSGVVRNPNLLDYKFPTCVDLPDLECAFVETVEPQSAYGHKALGEP
PIISPGPAIRNAIRMATGVAINALPITPKTLYREFVQAGLIRE
NT seq 2292 nt   +upstreamnt  +downstreamnt
atgtctttaggatcgccgctgcggcgggttgatgccgaagccaaggtcaccggacaggcg
cgttataccgatgatatgatgatgcccggcatgctccatgcctgctacgtgcgcagccgt
atcgcccacggtaacgtcaccgccatcgatacccgggaagcggagtccatgcccggcgta
gaagccgtcttcacctttcacgatgtcccctcagcccccttccctaccgccggccacgcc
tggtcgctggagccgggcaaacgggatatcgccgatcgccatctgctgaccggccacgtg
cgccactttggcgacggcgtcgccatcgtcgtcgcccgcgatctgctcagtgccgagcgc
gccgcggcgcgggtacaggtcagctatgatgcgttgccggtgatcacccggccacaggcg
gccctggccgacggagcaccggccattcaccccggcggcaatttgctgcgccacagcgag
atcgacgccggagagccagaagcccgcatcgccgccgccgatctgcagctggagggtcac
tacgagacgccggtggtgcagcactgccacatggagggcgtgacctgctatgcctatatg
gagcagcccgatcacatcgtcattgtctccagcacccaaattccccagattgtccggcgc
accgtcgcccaggccctcggtctcccctggtcgcacgtccgggtgatcaagccctacgtc
ggcggcggattcggcaataagcaggatgtgctggaagagcccatggccgcctttttaacc
cagcgcctcggcggtaaaccggtcaaggtcagcctgagccgggaggagtgcttcgtcgcc
acccgcacccgccacgccttcagcatcgatgcccggctgggtatgcgccgggatggtcag
ctggaggggtaccgtctgacggtgctgtccaataccggcgcctatgcctctcacggccac
tcaattgccgccgccggtgccaataaaatcagctatctctatccccgcagcgcctttggc
tactgcgctgatacggtatataccaacctgcccgccgccggtgcgatgcgcggctacggc
gcgccacaggtcgacttcgccctggagtgcctgatggacgacgccgcggcccgcctcgat
ctcgatcccctcgaggttcgtctgcgcaacgttgcgcgtcagggcgaccgcaacccggtt
aacggaaagagcatctacagcgccgggctcacagagtgcctggaaaaaggccgccgtctg
tttgagtgggatcggcgccgcgccgaatgtatggcccagtcggccgatgcgccggtgcgg
cgcggcgtcggcgtcgcctgtttcagctatggttccaatacctatccggtcggggtggag
atcgccggcgcccgtctgctgctcaatcaggacgggacggtaaacctgcagattggcgct
accgaaattggccagggatccgataccgtcttcgcccagatggcatcggaaacgctgggg
atcccctttaaacagatccgggtgatctcaactcaggataccgatatcaccgccttcgat
cccggcgcctttgcctcacggcaaagctatgtcgccgccccggcgatccgccgctcggcg
gagatcatgcgtcagaaaatcctggcgcacgcggcgctgataagtcaccagccggagtgg
ggattgaccctgtgcgacggtaacgtagtgatggcgatgcagccggatcaggtgctgatg
agcgtcgccgacgtcgccatgcaggcctactaccaccaggagatcggcgcacagatcctg
gccgaggtctcccataaaaccaccaccaatcccccggccttcggctgcacctttgtcgat
ctcagcatcgacatcgcgctgtgccaggtcaccattaaccgcatcctgaatctgcatgac
tccgggcggatcctcaacccgcagctggcggagggacaggttcacggcggtatggggatg
gggatcggctgggcgctgttcgaagagatgatcatcgatgagaagagcggcgtggtacgc
aacccgaatctgctcgactacaaattccccacctgtgtcgatctgccggatctggagtgc
gccttcgtcgaaacggtggagccgcagtcggcctatggccacaaggcgctgggggagccg
ccgatcatttcgcctggaccggcgatccgcaacgccattcgcatggcaacgggggtcgcg
atcaatgcgctgccgatcacccccaaaacgctgtatcgcgaatttgtgcaggccggactg
atcagggagtaa

DBGET integrated database retrieval system